BLASTX nr result
ID: Akebia25_contig00033153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033153 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828472.1| hypothetical protein AMTR_s00060p00144370 [A... 40 3e-06 >ref|XP_006828472.1| hypothetical protein AMTR_s00060p00144370 [Amborella trichopoda] gi|548833220|gb|ERM95888.1| hypothetical protein AMTR_s00060p00144370 [Amborella trichopoda] Length = 548 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +2 Query: 191 EMERKGVPLDKMILTTLIDDHFKVGNRIR 277 EME++G+ DK+I TTLID HFK GN I+ Sbjct: 322 EMEKRGLWPDKLIFTTLIDAHFKEGNMIK 350 Score = 36.6 bits (83), Expect(2) = 3e-06 Identities = 19/34 (55%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = +3 Query: 105 IRLDVAAYGAVIRGLCSKGMLNKA----IELGKR 194 I+LDV AYGA+I GLC KG L +A +E+ KR Sbjct: 293 IKLDVQAYGAIIWGLCKKGQLCEAEGLMVEMEKR 326