BLASTX nr result
ID: Akebia25_contig00033104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00033104 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210587.1| hypothetical protein PRUPE_ppa016105mg, part... 61 1e-07 ref|XP_007227239.1| hypothetical protein PRUPE_ppa018267mg [Prun... 57 2e-06 >ref|XP_007210587.1| hypothetical protein PRUPE_ppa016105mg, partial [Prunus persica] gi|462406322|gb|EMJ11786.1| hypothetical protein PRUPE_ppa016105mg, partial [Prunus persica] Length = 567 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -1 Query: 120 PMIRVMRSV*IEVPNLDGRLDPKAFLDWLSNMDHFFKWHE 1 P RVMRSV ++ PN DG L+PKA LDWL+ +DH+F+WH+ Sbjct: 91 PDERVMRSVKVDAPNFDGELNPKALLDWLATIDHYFEWHD 130 >ref|XP_007227239.1| hypothetical protein PRUPE_ppa018267mg [Prunus persica] gi|462424175|gb|EMJ28438.1| hypothetical protein PRUPE_ppa018267mg [Prunus persica] Length = 513 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -1 Query: 120 PMIRVMRSV*IEVPNLDGRLDPKAFLDWLSNMDHFFKWHE 1 P RVMRSV ++ PN D L+PKA LDWL+ MD +F+WH+ Sbjct: 44 PDERVMRSVQVDAPNFDAELNPKALLDWLATMDRYFEWHD 83