BLASTX nr result
ID: Akebia25_contig00032915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032915 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64078.1| hypothetical protein VITISV_041213 [Vitis vinifera] 56 6e-06 emb|CAN66803.1| hypothetical protein VITISV_041906 [Vitis vinifera] 56 6e-06 >emb|CAN64078.1| hypothetical protein VITISV_041213 [Vitis vinifera] Length = 1017 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -1 Query: 188 SIPTSY*GLSLGARYRSSSIWDPVIEMVTRRLGSWKSRYISR 63 S+PTSY GL LGA+YRS ++WD V E + ++L WKS+YIS+ Sbjct: 663 SLPTSYLGLPLGAQYRSXAVWDGVEERMRKKLARWKSQYISK 704 >emb|CAN66803.1| hypothetical protein VITISV_041906 [Vitis vinifera] Length = 292 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -1 Query: 188 SIPTSY*GLSLGARYRSSSIWDPVIEMVTRRLGSWKSRYISR 63 S+PTSY GL LGA+YRS ++WD V E + ++L WKS+YIS+ Sbjct: 35 SLPTSYLGLPLGAQYRSRAVWDGVEERMRKKLARWKSQYISK 76