BLASTX nr result
ID: Akebia25_contig00032739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032739 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593597.1| Telomerase-binding protein EST1A [Medicago t... 56 6e-06 gb|ABB00038.1| reverse transcriptase family member [Glycine max] 56 6e-06 >ref|XP_003593597.1| Telomerase-binding protein EST1A [Medicago truncatula] gi|355482645|gb|AES63848.1| Telomerase-binding protein EST1A [Medicago truncatula] Length = 1189 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = -2 Query: 194 MMIVRWMSGKTKKDKIRNKGI*KNVGVALIGYKLKES*SRWFEHVQ*RLITAQLEEIYKL 15 MM++RWMSGKT+ D+IRN I + VGVA I KL E+ RWF HV+ R + + + ++ Sbjct: 1091 MMMLRWMSGKTRHDRIRNDTIGERVGVAPIVKKLVENRLRWFVHVERRPVDVVVRRVDQM 1150 Query: 14 K 12 + Sbjct: 1151 E 1151 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/61 (44%), Positives = 42/61 (68%) Frame = -2 Query: 194 MMIVRWMSGKTKKDKIRNKGI*KNVGVALIGYKLKES*SRWFEHVQ*RLITAQLEEIYKL 15 M ++RWM GKT++DKIRN+ I + VGVA I K+ E+ RWF HV+ R + + L + ++ Sbjct: 268 MRMLRWMCGKTRQDKIRNEAIRERVGVAPIVEKMVENRLRWFGHVERRPVDSVLRRVDQM 327 Query: 14 K 12 + Sbjct: 328 E 328