BLASTX nr result
ID: Akebia25_contig00032656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032656 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 57 2e-08 ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibi... 55 8e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 57.0 bits (136), Expect(2) = 2e-08 Identities = 31/63 (49%), Positives = 38/63 (60%) Frame = +3 Query: 45 RHHLVILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFARIN*LNSQLETGELEFTPNRS* 224 RH LVILPL AG RCSVKPASR LRS+N++T AFA+ + G P++ Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQGR 75 Query: 225 PVG 233 P G Sbjct: 76 PTG 78 Score = 27.3 bits (59), Expect(2) = 2e-08 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 214 TGPSQSESNQRPTTLMPPLRLQVNA 288 TGP Q RP TLMP LRLQ +A Sbjct: 77 TGPEQ-----RPITLMPLLRLQAHA 96 >ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] gi|508714675|gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] Length = 686 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = +3 Query: 48 HHLVILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFARIN*LNSQLETGELE 203 H LVILPL S RCSVKPASRG L S+N+ QA+AR N QL TG+ E Sbjct: 2 HWLVILPLFVTESFRCSVKPASRGALLSRNQEAQAYARTPWFNYQLGTGKPE 53