BLASTX nr result
ID: Akebia25_contig00032478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032478 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q945U1.1|RS15_ELAOL RecName: Full=40S ribosomal protein S15 g... 63 4e-08 gb|ADR71252.1| 40S ribosomal protein S15E [Hevea brasiliensis] 63 4e-08 gb|ADR71251.1| 40S ribosomal protein S15D [Hevea brasiliensis] 63 4e-08 emb|CBI26366.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_002284241.1| PREDICTED: 40S ribosomal protein S15-like is... 63 4e-08 gb|ACI14379.1| 40S ribosomal protein S15-like protein [Forsythia... 63 4e-08 sp|O65059.1|RS15_PICMA RecName: Full=40S ribosomal protein S15 g... 62 1e-07 ref|XP_002972013.1| hypothetical protein SELMODRAFT_172403 [Sela... 62 1e-07 ref|XP_001761245.1| predicted protein [Physcomitrella patens] gi... 62 1e-07 ref|XP_001767284.1| predicted protein [Physcomitrella patens] gi... 62 1e-07 ref|XP_001777593.1| predicted protein [Physcomitrella patens] gi... 62 1e-07 gb|AAN04095.1| S15 ribosomal protein [Dunaliella tertiolecta] gi... 60 2e-07 ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citr... 60 4e-07 gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] 59 5e-07 gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] 59 5e-07 ref|XP_007034979.1| 40S ribosomal protein S15-like isoform 1 [Th... 59 5e-07 ref|XP_007050396.1| 40S ribosomal protein S15-like [Theobroma ca... 59 5e-07 ref|XP_004302063.1| PREDICTED: 40S ribosomal protein S15-like [F... 59 5e-07 ref|XP_004288443.1| PREDICTED: 40S ribosomal protein S15-like is... 59 5e-07 ref|XP_004288442.1| PREDICTED: 40S ribosomal protein S15-like is... 59 5e-07 >sp|Q945U1.1|RS15_ELAOL RecName: Full=40S ribosomal protein S15 gi|15425963|gb|AAK97632.1| 40S ribosomal protein S15 [Elaeis oleifera] Length = 153 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 41 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 71 >gb|ADR71252.1| 40S ribosomal protein S15E [Hevea brasiliensis] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 39 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 69 >gb|ADR71251.1| 40S ribosomal protein S15D [Hevea brasiliensis] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 39 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 69 >emb|CBI26366.3| unnamed protein product [Vitis vinifera] Length = 118 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 6 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 36 >ref|XP_002284241.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Vitis vinifera] gi|359477606|ref|XP_003632002.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Vitis vinifera] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 39 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 69 >gb|ACI14379.1| 40S ribosomal protein S15-like protein [Forsythia suspensa] Length = 151 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 39 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 69 >sp|O65059.1|RS15_PICMA RecName: Full=40S ribosomal protein S15 gi|2982268|gb|AAC32121.1| probable 40S ribosomal protein S15 [Picea mariana] gi|116778880|gb|ABK21037.1| unknown [Picea sitchensis] gi|116790999|gb|ABK25817.1| unknown [Picea sitchensis] gi|116793646|gb|ABK26826.1| unknown [Picea sitchensis] gi|224284325|gb|ACN39898.1| unknown [Picea sitchensis] Length = 151 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLFHARARRRFQRGLKR+PMALIKKLRKA Sbjct: 39 LVKLFHARARRRFQRGLKRQPMALIKKLRKA 69 >ref|XP_002972013.1| hypothetical protein SELMODRAFT_172403 [Selaginella moellendorffii] gi|302781552|ref|XP_002972550.1| hypothetical protein SELMODRAFT_172857 [Selaginella moellendorffii] gi|300160017|gb|EFJ26636.1| hypothetical protein SELMODRAFT_172857 [Selaginella moellendorffii] gi|300160312|gb|EFJ26930.1| hypothetical protein SELMODRAFT_172403 [Selaginella moellendorffii] Length = 152 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LV+LFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVELFHARARRRFQRGLKRKPMALIKKLRKA 70 >ref|XP_001761245.1| predicted protein [Physcomitrella patens] gi|162687585|gb|EDQ73967.1| predicted protein [Physcomitrella patens] Length = 150 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LV+LFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 38 LVELFHARARRRFQRGLKRKPMALIKKLRKA 68 >ref|XP_001767284.1| predicted protein [Physcomitrella patens] gi|162681539|gb|EDQ67965.1| predicted protein [Physcomitrella patens] Length = 146 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LV+LFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 34 LVELFHARARRRFQRGLKRKPMALIKKLRKA 64 >ref|XP_001777593.1| predicted protein [Physcomitrella patens] gi|162671078|gb|EDQ57636.1| predicted protein [Physcomitrella patens] Length = 150 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LV+LFHARARRRFQRGLKRKPMALIKKLRKA Sbjct: 38 LVELFHARARRRFQRGLKRKPMALIKKLRKA 68 >gb|AAN04095.1| S15 ribosomal protein [Dunaliella tertiolecta] gi|22655535|gb|AAN04096.1| S15 ribosomal protein [Dunaliella tertiolecta] Length = 144 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LV+LFHARARRRFQRGLKRKP+ALIKKLRKA Sbjct: 32 LVELFHARARRRFQRGLKRKPLALIKKLRKA 62 >ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] gi|568872733|ref|XP_006489520.1| PREDICTED: 40S ribosomal protein S15-like [Citrus sinensis] gi|557521990|gb|ESR33357.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] Length = 155 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 43 LVKLFSARARRRFQRGLKRKPMALIKKLRKA 73 >gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFTARARRRFQRGLKRKPMALIKKLRKA 70 >gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFTARARRRFQRGLKRKPMALIKKLRKA 70 >ref|XP_007034979.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|590658896|ref|XP_007034980.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|508714008|gb|EOY05905.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] gi|508714009|gb|EOY05906.1| 40S ribosomal protein S15-like isoform 1 [Theobroma cacao] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFPARARRRFQRGLKRKPMALIKKLRKA 70 >ref|XP_007050396.1| 40S ribosomal protein S15-like [Theobroma cacao] gi|508702657|gb|EOX94553.1| 40S ribosomal protein S15-like [Theobroma cacao] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFPARARRRFQRGLKRKPMALIKKLRKA 70 >ref|XP_004302063.1| PREDICTED: 40S ribosomal protein S15-like [Fragaria vesca subsp. vesca] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFPARARRRFQRGLKRKPMALIKKLRKA 70 >ref|XP_004288443.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 118 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 6 LVKLFPARARRRFQRGLKRKPMALIKKLRKA 36 >ref|XP_004288442.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LVKLFHARARRRFQRGLKRKPMALIKKLRKA 95 LVKLF ARARRRFQRGLKRKPMALIKKLRKA Sbjct: 40 LVKLFPARARRRFQRGLKRKPMALIKKLRKA 70