BLASTX nr result
ID: Akebia25_contig00032385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032385 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003046573.1| hypothetical protein NECHADRAFT_58149 [Nectr... 78 1e-12 gb|EMR69322.1| putative acyl binding protein [Eutypa lata UCREL1] 76 4e-12 ref|XP_007290769.1| acyl CoA binding protein [Marssonina brunnea... 72 1e-10 ref|XP_002622326.1| conserved hypothetical protein [Ajellomyces ... 71 1e-10 gb|EHY54403.1| diazepam-binding inhibitor [Exophiala dermatitidi... 70 2e-10 ref|XP_001240772.1| predicted protein [Coccidioides immitis RS] ... 70 4e-10 gb|EKG10105.1| Acyl-CoA-binding protein ACBP [Macrophomina phase... 69 5e-10 gb|EXJ57906.1| diazepam-binding inhibitor (GABA receptor modulat... 69 7e-10 gb|EPE02513.1| acyl binding protein [Ophiostoma piceae UAMH 11346] 69 9e-10 emb|CCF42842.1| acyl CoA binding protein [Colletotrichum higgins... 69 9e-10 ref|XP_006694261.1| putative fatty acid binding protein [Chaetom... 69 9e-10 ref|XP_001390082.1| acyl CoA binding family protein [Aspergillus... 69 9e-10 gb|EQB51495.1| acyl CoA binding protein [Colletotrichum gloeospo... 68 1e-09 ref|XP_007279752.1| acyl CoA binding protein [Colletotrichum glo... 68 1e-09 ref|XP_002849186.1| conserved hypothetical protein [Arthroderma ... 68 1e-09 gb|EEH45213.1| conserved hypothetical protein [Paracoccidioides ... 68 1e-09 ref|XP_002791723.1| conserved hypothetical protein [Paracoccidio... 68 1e-09 gb|EEH20624.1| hypothetical protein PABG_02855, partial [Paracoc... 68 1e-09 gb|EPE33078.1| Acyl-CoA binding protein [Glarea lozoyensis ATCC ... 67 2e-09 gb|EXJ92187.1| diazepam-binding inhibitor (GABA receptor modulat... 67 3e-09 >ref|XP_003046573.1| hypothetical protein NECHADRAFT_58149 [Nectria haematococca mpVI 77-13-4] gi|256727500|gb|EEU40860.1| hypothetical protein NECHADRAFT_58149 [Nectria haematococca mpVI 77-13-4] Length = 105 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 3/62 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LYAL K+ GE+ APGTFDF GKAKYN WKK+ DEG+T +AA ++YV+LV LK K Sbjct: 31 LYALYKVGTGEDFSKATAPGTFDFKGKAKYNAWKKVVDEGVTPDAAQEQYVKLVEELKEK 90 Query: 173 YG 178 YG Sbjct: 91 YG 92 >gb|EMR69322.1| putative acyl binding protein [Eutypa lata UCREL1] Length = 102 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/65 (58%), Positives = 44/65 (67%), Gaps = 3/65 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LY L K+A GE+ APG FD GKAKYN WKKL +EGITAE A ++Y+ V LKGK Sbjct: 29 LYGLYKVANGEDFSKAPAPGMFDLKGKAKYNAWKKLAEEGITAEQAQERYIAKVEELKGK 88 Query: 173 YGVKA 187 YG A Sbjct: 89 YGYDA 93 >ref|XP_007290769.1| acyl CoA binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865597|gb|EKD18638.1| acyl CoA binding protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 99 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LY L K+A GE+ + PGTFD GKAK W+K+ DEGIT++ A +KYVELV +LK K Sbjct: 26 LYGLYKVASGEDITKSEQPGTFDLKGKAKKRAWQKIVDEGITSDQAKEKYVELVESLKEK 85 Query: 173 YGVKA 187 YG A Sbjct: 86 YGYDA 90 >ref|XP_002622326.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239589642|gb|EEQ72285.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239608616|gb|EEQ85603.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] gi|327353752|gb|EGE82609.1| acyl CoA binding family protein [Ajellomyces dermatitidis ATCC 18188] gi|531978485|gb|EQL29072.1| diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) [Ajellomyces dermatitidis ATCC 26199] Length = 106 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K E P PGTFDF GK KYN WKK+ DEG+++E A K+YVEL+ LK Sbjct: 31 LYALFKQGTQEPPFEEAPKPGTFDFKGKYKYNSWKKVADEGLSSEDAQKQYVELIEKLKE 90 Query: 170 KYG 178 KYG Sbjct: 91 KYG 93 >gb|EHY54403.1| diazepam-binding inhibitor [Exophiala dermatitidis NIH/UT8656] Length = 102 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LYAL K+A GE+ APG FD GKAK+ W+K D G +A A+K+Y+ELVNTLK K Sbjct: 28 LYALFKVANGEDFSKAPAPGMFDLKGKAKHKAWQKEVDAGTSAADAEKRYIELVNTLKSK 87 Query: 173 YG 178 YG Sbjct: 88 YG 89 >ref|XP_001240772.1| predicted protein [Coccidioides immitis RS] gi|303310199|ref|XP_003065112.1| Acyl CoA binding family protein [Coccidioides posadasii C735 delta SOWgp] gi|240104772|gb|EER22967.1| Acyl CoA binding family protein [Coccidioides posadasii C735 delta SOWgp] gi|320034011|gb|EFW15957.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|392867269|gb|EAS29509.2| hypothetical protein CIMG_07935 [Coccidioides immitis RS] Length = 104 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 4/63 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K + P PGTFDF GK KYN WK + +EG+T E A K+YVEL+ LK Sbjct: 30 LYALFKQGMQDPPFETAPVPGTFDFKGKYKYNKWKSIVEEGVTPEEAQKRYVELIEKLKA 89 Query: 170 KYG 178 KYG Sbjct: 90 KYG 92 >gb|EKG10105.1| Acyl-CoA-binding protein ACBP [Macrophomina phaseolina MS6] Length = 92 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +2 Query: 2 LYALAKIAKGE--EPKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGKY 175 LYALAKIA+ E E K PG FD GK NHW+K DEG+T E A +YVELV K Y Sbjct: 30 LYALAKIAQNEDIEQKKPGMFDIKGKTMRNHWQKKLDEGVTPEQARDQYVELVEKFKKTY 89 Query: 176 GVK 184 G K Sbjct: 90 GTK 92 >gb|EXJ57906.1| diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) [Cladophialophora yegresii CBS 114405] Length = 102 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/62 (54%), Positives = 43/62 (69%), Gaps = 3/62 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LYAL K+A GE+ APG FD GKAK+ W+K D G +A A+KKY++LVN LKG+ Sbjct: 28 LYALFKVANGEDISKAPAPGMFDLKGKAKHKAWQKEVDAGTSAADAEKKYIDLVNKLKGQ 87 Query: 173 YG 178 YG Sbjct: 88 YG 89 >gb|EPE02513.1| acyl binding protein [Ophiostoma piceae UAMH 11346] Length = 101 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 3/65 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 +YAL K+A GE+ APG FD GKAK N W+K+ DEGITAE A KYV + LK K Sbjct: 27 IYALYKVATGEDITTAPAPGVFDLKGKAKKNAWQKVVDEGITAEEAQAKYVAYIEELKAK 86 Query: 173 YGVKA 187 +G A Sbjct: 87 HGYDA 91 >emb|CCF42842.1| acyl CoA binding protein [Colletotrichum higginsianum] Length = 104 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEE----PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LY L K++ GE+ PK PG FD GKAK + W+K+ DEG T E A +KYV LVNTLK Sbjct: 31 LYGLYKVSTGEDISSAPK-PGMFDLKGKAKQSAWQKVVDEGTTPEQAQEKYVALVNTLKE 89 Query: 170 KYGVKA 187 KYG A Sbjct: 90 KYGYDA 95 >ref|XP_006694261.1| putative fatty acid binding protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340960784|gb|EGS21965.1| putative fatty acid binding protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 104 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/62 (53%), Positives = 40/62 (64%), Gaps = 3/62 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 +YAL K+ GE+ PG FD GKAKYN WKKL D+G+T E A +KYV V +K K Sbjct: 30 IYALYKVGNGEDFSKAPQPGMFDLKGKAKYNAWKKLVDDGLTPEEAQEKYVAKVEEMKAK 89 Query: 173 YG 178 YG Sbjct: 90 YG 91 >ref|XP_001390082.1| acyl CoA binding family protein [Aspergillus niger CBS 513.88] gi|134057758|emb|CAK38153.1| unnamed protein product [Aspergillus niger] gi|350632666|gb|EHA21033.1| hypothetical protein ASPNIDRAFT_194452 [Aspergillus niger ATCC 1015] Length = 88 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = +2 Query: 2 LYALAKIAK----GEEPKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LY+L K+ E PK PGTFDF GK KYN WK+L DEG+T++ A ++Y+ LV LK Sbjct: 26 LYSLYKVGTQSNFAEAPK-PGTFDFAGKYKYNGWKRLHDEGVTSDEAQERYIFLVEALKE 84 Query: 170 KYG 178 KYG Sbjct: 85 KYG 87 >gb|EQB51495.1| acyl CoA binding protein [Colletotrichum gloeosporioides Cg-14] Length = 104 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/66 (54%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEE----PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K+ GE+ PK PG FD GKAKYN W+K+ DEG T E A ++Y+ LVN LK Sbjct: 31 LYALYKVGTGEKIADAPK-PGMFDLKGKAKYNSWQKVVDEGKTVEQAQEEYIALVNKLKE 89 Query: 170 KYGVKA 187 YG A Sbjct: 90 SYGYDA 95 >ref|XP_007279752.1| acyl CoA binding protein [Colletotrichum gloeosporioides Nara gc5] gi|429856257|gb|ELA31179.1| acyl CoA binding protein [Colletotrichum gloeosporioides Nara gc5] Length = 104 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/66 (54%), Positives = 43/66 (65%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEE----PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K+ GE+ PK PG FD GKAKYN W+K+ DEG T E A ++Y+ LVN LK Sbjct: 31 LYALYKVGTGEKIADAPK-PGMFDLKGKAKYNSWQKVVDEGKTVEQAQEEYIALVNKLKE 89 Query: 170 KYGVKA 187 YG A Sbjct: 90 SYGYDA 95 >ref|XP_002849186.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238839639|gb|EEQ29301.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 102 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 4/63 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K K + P APG FDF GK K+ WK++ DEGI+ E A +KYVELV LK Sbjct: 27 LYALFKQGKQDPPFDQAPAPGMFDFKGKYKHGKWKEIVDEGISPEQAQEKYVELVEKLKA 86 Query: 170 KYG 178 KYG Sbjct: 87 KYG 89 >gb|EEH45213.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 106 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K + P PGTFDF GK KYN WKK+ +EG++AE A +KYV LV K Sbjct: 31 LYALFKQGTQDPPFEDAPKPGTFDFKGKYKYNAWKKIAEEGLSAEEAQEKYVSLVEKFKE 90 Query: 170 KYGVKA 187 KYG A Sbjct: 91 KYGYDA 96 >ref|XP_002791723.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226279849|gb|EEH35415.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 106 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K + P PGTFDF GK KYN WKK+ +EG++AE A +KYV LV K Sbjct: 31 LYALFKQGTQDPPFDDAPKPGTFDFKGKYKYNAWKKIAEEGLSAEEAQEKYVSLVEKFKE 90 Query: 170 KYGVKA 187 KYG A Sbjct: 91 KYGYDA 96 >gb|EEH20624.1| hypothetical protein PABG_02855, partial [Paracoccidioides brasiliensis Pb03] Length = 111 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +2 Query: 2 LYALAKIAKGEEP----KAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKG 169 LYAL K + P PGTFDF GK KYN WKK+ +EG++AE A +KYV LV K Sbjct: 36 LYALFKQGTQDPPFEDAPKPGTFDFKGKYKYNAWKKIAEEGLSAEEAQEKYVSLVEKFKE 95 Query: 170 KYGVKA 187 KYG A Sbjct: 96 KYGYDA 101 >gb|EPE33078.1| Acyl-CoA binding protein [Glarea lozoyensis ATCC 20868] Length = 99 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/65 (52%), Positives = 44/65 (67%), Gaps = 3/65 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LY L K+A GE+ +APG FD GKAK W+K DEG++ +AA ++YV+LV TLK K Sbjct: 26 LYGLYKVATGEDIAKAEAPGMFDLKGKAKKKSWQKYVDEGLSQDAAKEQYVKLVGTLKEK 85 Query: 173 YGVKA 187 YG A Sbjct: 86 YGYDA 90 >gb|EXJ92187.1| diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) [Capronia epimyces CBS 606.96] Length = 102 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/62 (56%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = +2 Query: 2 LYALAKIAKGEE---PKAPGTFDFTGKAKYNHWKKLKDEGITAEAADKKYVELVNTLKGK 172 LYAL K+A GE+ APG FD GKAK+ W+K D G TA A+K+YVELV LK K Sbjct: 28 LYALFKVANGEDFSKATAPGMFDLKGKAKHKAWQKEVDAGTTAADAEKRYVELVGKLKEK 87 Query: 173 YG 178 YG Sbjct: 88 YG 89