BLASTX nr result
ID: Akebia25_contig00032314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032314 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [B... 80 4e-13 ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria trit... 80 4e-13 ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [... 78 1e-12 gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] 78 1e-12 ref|XP_754942.1| 40S ribosomal protein S27 [Aspergillus fumigatu... 77 2e-12 ref|XP_003190521.1| 40S ribosomal protein S27 [Aspergillus oryza... 77 2e-12 gb|EDP53070.1| 40S ribosomal protein S27, putative [Aspergillus ... 77 2e-12 ref|XP_001394925.1| 40S ribosomal protein S27 [Aspergillus niger... 77 2e-12 ref|XP_001263787.1| 40S ribosomal protein S27 [Neosartorya fisch... 77 2e-12 ref|XP_001217341.1| 40S ribosomal protein S27 [Aspergillus terre... 77 2e-12 emb|CDM31909.1| 40S ribosomal protein S27 [Penicillium roqueforti] 77 3e-12 dbj|GAD92245.1| 40S ribosomal protein S27 [Byssochlamys spectabi... 77 3e-12 emb|CCU77415.1| 40S ribosomal protein S27 [Blumeria graminis f. ... 77 3e-12 gb|EPS26892.1| hypothetical protein PDE_01832 [Penicillium oxali... 77 3e-12 gb|EPQ64747.1| Protein component of the small (40S) ribosomal su... 77 3e-12 gb|EMR88546.1| putative 40s ribosomal protein s27 protein [Botry... 77 3e-12 gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein ... 77 3e-12 gb|ELR07139.1| 40S ribosomal protein S27 [Pseudogymnoascus destr... 77 3e-12 ref|XP_007292816.1| 40S ribosomal protein S27 [Marssonina brunne... 77 3e-12 gb|EHL01289.1| putative 40S ribosomal protein S27 [Glarea lozoye... 77 3e-12 >gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [Baudoinia compniacensis UAMH 10762] Length = 81 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 46 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 81 >ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria tritici IPO323] gi|339467582|gb|EGP82685.1| hypothetical protein MYCGRDRAFT_64763 [Zymoseptoria tritici IPO323] gi|452986834|gb|EME86590.1| hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] gi|453079947|gb|EMF07999.1| 40S ribosomal protein S27 [Sphaerulina musiva SO2202] Length = 82 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] gi|485917878|gb|EOD44675.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] Length = 82 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] Length = 82 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_754942.1| 40S ribosomal protein S27 [Aspergillus fumigatus Af293] gi|121704840|ref|XP_001270683.1| 40S ribosomal protein S27 [Aspergillus clavatus NRRL 1] gi|66852579|gb|EAL92904.1| 40S ribosomal protein S27, putative [Aspergillus fumigatus Af293] gi|119398829|gb|EAW09257.1| 40S ribosomal protein S27, putative [Aspergillus clavatus NRRL 1] Length = 82 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003190521.1| 40S ribosomal protein S27 [Aspergillus oryzae RIB40] Length = 82 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >gb|EDP53070.1| 40S ribosomal protein S27, putative [Aspergillus fumigatus A1163] Length = 112 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 77 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 112 >ref|XP_001394925.1| 40S ribosomal protein S27 [Aspergillus niger CBS 513.88] gi|134079624|emb|CAK40840.1| unnamed protein product [Aspergillus niger] gi|358369158|dbj|GAA85773.1| 40S ribosomal protein S27 [Aspergillus kawachii IFO 4308] Length = 82 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_001263787.1| 40S ribosomal protein S27 [Neosartorya fischeri NRRL 181] gi|119411947|gb|EAW21890.1| 40S ribosomal protein S27, putative [Neosartorya fischeri NRRL 181] Length = 122 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 87 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 122 >ref|XP_001217341.1| 40S ribosomal protein S27 [Aspergillus terreus NIH2624] gi|114189187|gb|EAU30887.1| 40S ribosomal protein S27 [Aspergillus terreus NIH2624] Length = 82 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVVVCAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVVCAGCSTVLCQPTGGKARLTEGCSFRRK 82 >emb|CDM31909.1| 40S ribosomal protein S27 [Penicillium roqueforti] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82 >dbj|GAD92245.1| 40S ribosomal protein S27 [Byssochlamys spectabilis No. 5] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82 >emb|CCU77415.1| 40S ribosomal protein S27 [Blumeria graminis f. sp. hordei DH14] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82 >gb|EPS26892.1| hypothetical protein PDE_01832 [Penicillium oxalicum 114-2] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82 >gb|EPQ64747.1| Protein component of the small (40S) ribosomal subunit, partial [Blumeria graminis f. sp. tritici 96224] Length = 81 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 46 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 81 >gb|EMR88546.1| putative 40s ribosomal protein s27 protein [Botryotinia fuckeliana BcDW1] Length = 115 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 80 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 115 >gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein [Dothistroma septosporum NZE10] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 +SHAQTVV CAGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 47 YSHAQTVVTCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|ELR07139.1| 40S ribosomal protein S27 [Pseudogymnoascus destructans 20631-21] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_007292816.1| 40S ribosomal protein S27 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863411|gb|EKD16458.1| 40S ribosomal protein S27 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 96 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 61 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 96 >gb|EHL01289.1| putative 40S ribosomal protein S27 [Glarea lozoyensis 74030] Length = 82 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 359 FSHAQTVVVCAGCSQVLCQPTGGKARLTEGCSFRRK 252 FSHAQTVV+CAGCS VLCQPTGGKARLTEGCSFRRK Sbjct: 47 FSHAQTVVICAGCSTVLCQPTGGKARLTEGCSFRRK 82