BLASTX nr result
ID: Akebia25_contig00032004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00032004 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40375.1| hypothetical protein DOTSEDRAFT_56583 [Dothistrom... 87 2e-15 >gb|EME40375.1| hypothetical protein DOTSEDRAFT_56583 [Dothistroma septosporum NZE10] Length = 191 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = -3 Query: 241 RKILEEAHKNRDNPEHPAHKDHPKHGEFLKSIPKRLXXXXXXXXXXXXXGDLVNGMI 71 +KILEEAHKN+DNPEHPAHKDHPKHGEFLKSIPKRL DLVNGM+ Sbjct: 133 KKILEEAHKNKDNPEHPAHKDHPKHGEFLKSIPKRLGGAAIFGAGATAGADLVNGML 189