BLASTX nr result
ID: Akebia25_contig00031981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00031981 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS61456.1| Protein HASTY 1 [Triticum urartu] 34 7e-06 >gb|EMS61456.1| Protein HASTY 1 [Triticum urartu] Length = 955 Score = 34.3 bits (77), Expect(3) = 7e-06 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -2 Query: 227 LSKNQFGLMLGRSLIEAIFLLGQMI 153 ++KNQFG M GRS +EAIFL+ Q++ Sbjct: 730 VTKNQFGFMPGRSTMEAIFLVRQLM 754 Score = 32.7 bits (73), Expect(3) = 7e-06 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -3 Query: 154 YRKEEESSYN-FIDLEKTNY*IPRKLIWWELRKKGV 50 YR++++ + FIDLEK IPR ++WW L K V Sbjct: 757 YREQKKDLHMLFIDLEKAYDKIPRNVMWWALEKHKV 792 Score = 27.3 bits (59), Expect(3) = 7e-06 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -1 Query: 276 CTNHRGIKLTSYTIEVF 226 CT++RGIKLTS+T +++ Sbjct: 700 CTDYRGIKLTSHTTKLW 716