BLASTX nr result
ID: Akebia25_contig00031894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00031894 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844850.1| hypothetical protein AMTR_s00058p00097500 [A... 57 3e-06 ref|XP_006846779.1| hypothetical protein AMTR_s00148p00037080 [A... 56 6e-06 >ref|XP_006844850.1| hypothetical protein AMTR_s00058p00097500 [Amborella trichopoda] gi|548847341|gb|ERN06525.1| hypothetical protein AMTR_s00058p00097500 [Amborella trichopoda] Length = 895 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/79 (31%), Positives = 50/79 (63%) Frame = +2 Query: 2 LNQLLKKEADSILGVKDDVQYLCDLLKLMRAFLKDCEGVCQEQQDANMFLKEIRYLVYEA 181 L+QLL +E + GV +DV+++ D L+ ++AFL D + V + N ++++++ + Y+A Sbjct: 13 LDQLLTEEVQLLSGVSNDVRWINDELRSIKAFLNDADNVRETNTSVNAWVEQVQDVAYDA 72 Query: 182 EDVINTYVVSTREDNTRDG 238 EDV++T+++ R G Sbjct: 73 EDVLDTFIIQIARLQRRRG 91 >ref|XP_006846779.1| hypothetical protein AMTR_s00148p00037080 [Amborella trichopoda] gi|548849601|gb|ERN08360.1| hypothetical protein AMTR_s00148p00037080 [Amborella trichopoda] Length = 113 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/69 (33%), Positives = 48/69 (69%) Frame = +2 Query: 2 LNQLLKKEADSILGVKDDVQYLCDLLKLMRAFLKDCEGVCQEQQDANMFLKEIRYLVYEA 181 L++LL +E + GVKDD+Q++ D L++M+ FL D + + + + ++ ++R +VY+A Sbjct: 13 LDKLLTEEVQLLGGVKDDIQWIKDELQIMKPFLNDADKIRERDSVVDAWVAQVRDVVYDA 72 Query: 182 EDVINTYVV 208 EDV++ +++ Sbjct: 73 EDVLDNFIL 81