BLASTX nr result
ID: Akebia25_contig00031695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00031695 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS60113.1| hypothetical protein PaG_06112 [Pseudozyma aphidi... 55 1e-05 dbj|GAC75274.1| succinyl-coa synthetase, alpha subunit [Pseudozy... 55 1e-05 >gb|ETS60113.1| hypothetical protein PaG_06112 [Pseudozyma aphidis DSM 70725] Length = 709 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -2 Query: 251 DFAGRLYKLISLGLSIEDEPIAESASDEK---APEATSGESAMESID 120 DFA RLYKLISLGLSI+D + A+D+K A E +GESAMESID Sbjct: 663 DFANRLYKLISLGLSIDDAGLEADAADDKVEAATEEVAGESAMESID 709 >dbj|GAC75274.1| succinyl-coa synthetase, alpha subunit [Pseudozyma antarctica T-34] Length = 709 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -2 Query: 251 DFAGRLYKLISLGLSIEDEPIAESASDEK---APEATSGESAMESID 120 DFA RLYKLISLGLSI+D + A+D+K A E +GESAMESID Sbjct: 663 DFANRLYKLISLGLSIDDAGLEADAADDKVEAATEEVAGESAMESID 709