BLASTX nr result
ID: Akebia25_contig00031267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00031267 (627 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB96208.1| Armadillo repeat-containing kinesin-like protein ... 73 8e-11 ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus... 69 1e-09 ref|XP_004250053.1| PREDICTED: armadillo repeat-containing kines... 68 2e-09 ref|XP_006361681.1| PREDICTED: armadillo repeat-containing kines... 67 3e-09 ref|XP_002315323.2| hypothetical protein POPTR_0010s23370g [Popu... 67 3e-09 ref|XP_007221041.1| hypothetical protein PRUPE_ppa015323mg [Prun... 65 1e-08 gb|EYU39632.1| hypothetical protein MIMGU_mgv1a001575mg [Mimulus... 65 2e-08 ref|XP_004308769.1| PREDICTED: armadillo repeat-containing kines... 64 5e-08 ref|XP_004140076.1| PREDICTED: armadillo repeat-containing kines... 64 5e-08 ref|XP_006485599.1| PREDICTED: armadillo repeat-containing kines... 63 8e-08 ref|XP_006485598.1| PREDICTED: armadillo repeat-containing kines... 63 8e-08 ref|XP_006485597.1| PREDICTED: armadillo repeat-containing kines... 63 8e-08 ref|XP_006436496.1| hypothetical protein CICLE_v10030573mg [Citr... 63 8e-08 ref|XP_006843033.1| hypothetical protein AMTR_s00076p00183960 [A... 62 1e-07 ref|XP_004987171.1| PREDICTED: armadillo repeat-containing kines... 58 2e-06 tpg|DAA43430.1| TPA: hypothetical protein ZEAMMB73_039353 [Zea m... 58 2e-06 ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kines... 58 3e-06 ref|XP_003562070.1| PREDICTED: armadillo repeat-containing kines... 58 3e-06 emb|CBI31422.3| unnamed protein product [Vitis vinifera] 58 3e-06 ref|XP_007009968.1| Armadillo/beta-catenin repeat family protein... 57 3e-06 >gb|EXB96208.1| Armadillo repeat-containing kinesin-like protein 1 [Morus notabilis] Length = 1030 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E+N +DFISSG V EL+RIS ESS+EDIRNLAKKTL++N FQAEMQ Sbjct: 981 EDNARDFISSGGVKELVRISMESSKEDIRNLAKKTLRINSAFQAEMQ 1027 >ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] gi|223530934|gb|EEF32793.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] Length = 1051 Score = 68.6 bits (166), Expect = 1e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DFISSG EL+RIS ESSREDIRNLAKKTLKL+P F+ E Sbjct: 972 EDNVKDFISSGGTKELVRISVESSREDIRNLAKKTLKLSPSFETE 1016 >ref|XP_004250053.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Solanum lycopersicum] Length = 1084 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E N +DF+SSGA+DE++RIS ESSREDIRNLAKKTLKL+ F+A+++ Sbjct: 1037 EGNARDFVSSGALDEIVRISNESSREDIRNLAKKTLKLSSTFKAQIK 1083 >ref|XP_006361681.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Solanum tuberosum] Length = 1084 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E N +DF+SSGA+DE++RIS ESSREDIRNLAKKTLKL+ FQ +++ Sbjct: 1037 EGNARDFVSSGALDEIVRISNESSREDIRNLAKKTLKLSSTFQDQIR 1083 >ref|XP_002315323.2| hypothetical protein POPTR_0010s23370g [Populus trichocarpa] gi|550330439|gb|EEF01494.2| hypothetical protein POPTR_0010s23370g [Populus trichocarpa] Length = 1067 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEM 490 + N ++FIS G V EL+RIS ES+REDIRNLAKKTLK+NP FQAE+ Sbjct: 1017 DNNDREFISCGGVRELVRISVESNREDIRNLAKKTLKMNPTFQAEV 1062 >ref|XP_007221041.1| hypothetical protein PRUPE_ppa015323mg [Prunus persica] gi|462417503|gb|EMJ22240.1| hypothetical protein PRUPE_ppa015323mg [Prunus persica] Length = 1052 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEM 490 E+N +DFISSG ++E++RIS ESSREDIRNLAKK L++N FQ EM Sbjct: 1004 EDNARDFISSGGLNEIVRISVESSREDIRNLAKKALRVNSKFQNEM 1049 >gb|EYU39632.1| hypothetical protein MIMGU_mgv1a001575mg [Mimulus guttatus] Length = 792 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 EEN +DFISSGA+ ELI IS S++EDIRNLAKKTL+L+P+F+ E++ Sbjct: 744 EENGRDFISSGALKELIEISEGSAKEDIRNLAKKTLRLSPLFRKELR 790 >ref|XP_004308769.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Fragaria vesca subsp. vesca] Length = 1031 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEM 490 E+N DFI SG + EL+RIS ESSREDIRNLAKKTL+ +P FQ E+ Sbjct: 983 EDNANDFIFSGGLKELVRISAESSREDIRNLAKKTLRSSPKFQTEI 1028 >ref|XP_004140076.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Cucumis sativus] gi|449490427|ref|XP_004158602.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Cucumis sativus] Length = 1061 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 EEN DF++S V EL RIS ES++EDIRNLA+K LKLNP FQA+ Q Sbjct: 1007 EENADDFVNSDGVKELERISRESNKEDIRNLARKMLKLNPTFQAQAQ 1053 >ref|XP_006485599.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like isoform X3 [Citrus sinensis] Length = 1018 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DFIS G EL++IS ESSREDIRNLAKKT+K NP QA+ Sbjct: 971 EDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQAD 1015 >ref|XP_006485598.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like isoform X2 [Citrus sinensis] Length = 1075 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DFIS G EL++IS ESSREDIRNLAKKT+K NP QA+ Sbjct: 1028 EDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQAD 1072 >ref|XP_006485597.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like isoform X1 [Citrus sinensis] Length = 1085 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DFIS G EL++IS ESSREDIRNLAKKT+K NP QA+ Sbjct: 1038 EDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQAD 1082 >ref|XP_006436496.1| hypothetical protein CICLE_v10030573mg [Citrus clementina] gi|557538692|gb|ESR49736.1| hypothetical protein CICLE_v10030573mg [Citrus clementina] Length = 1085 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DFIS G EL++IS ESSREDIRNLAKKT+K NP QA+ Sbjct: 1038 EDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQAD 1082 >ref|XP_006843033.1| hypothetical protein AMTR_s00076p00183960 [Amborella trichopoda] gi|548845230|gb|ERN04708.1| hypothetical protein AMTR_s00076p00183960 [Amborella trichopoda] Length = 969 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E NT+D ISSG + ELIR+S+ES+R+DIRNLAK+ L ++P F++E+Q Sbjct: 920 EANTRDLISSGGLKELIRLSHESTRDDIRNLAKRILTISPAFRSEIQ 966 >ref|XP_004987171.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Setaria italica] Length = 946 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E+NT D I+SG + EL+RIS ES RED RNLAKK L NP F E+Q Sbjct: 900 EDNTCDIIASGGIKELLRISRESPREDTRNLAKKALDSNPAFLREVQ 946 >tpg|DAA43430.1| TPA: hypothetical protein ZEAMMB73_039353 [Zea mays] Length = 182 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 E+NT D I+SG + EL+RIS ES RED RNLAKK L NP F E+Q Sbjct: 136 EDNTCDIIASGGIKELLRISRESPREDTRNLAKKALDSNPAFLREIQ 182 >ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Vitis vinifera] Length = 1017 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEM 490 E N QDF SSG V EL RI+ ES+REDI+NLAKKTLK P FQAE+ Sbjct: 969 ENNAQDFKSSGGVRELKRIAAESTREDIQNLAKKTLKSTP-FQAEI 1013 >ref|XP_003562070.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Brachypodium distachyon] Length = 946 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEMQ 487 EEN++D I +G + ELIRIS ESSR+D RNLAKK L NP F E Q Sbjct: 900 EENSRDIIVTGGIKELIRISRESSRDDARNLAKKALTSNPAFLKETQ 946 >emb|CBI31422.3| unnamed protein product [Vitis vinifera] Length = 1331 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAEM 490 E N QDF SSG V EL RI+ ES+REDI+NLAKKTLK P FQAE+ Sbjct: 941 ENNAQDFKSSGGVRELKRIAAESTREDIQNLAKKTLKSTP-FQAEI 985 >ref|XP_007009968.1| Armadillo/beta-catenin repeat family protein / kinesin motor family protein isoform 1 [Theobroma cacao] gi|508726881|gb|EOY18778.1| Armadillo/beta-catenin repeat family protein / kinesin motor family protein isoform 1 [Theobroma cacao] Length = 1036 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 627 EENTQDFISSGAVDELIRISYESSREDIRNLAKKTLKLNPIFQAE 493 E+N +DF SSG + EL RIS ESSR+DIR+LAKK LK N +FQ + Sbjct: 986 EDNAKDFTSSGGLQELQRISMESSRDDIRDLAKKMLKSNTMFQGD 1030