BLASTX nr result
ID: Akebia25_contig00030837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030837 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 1... 81 3e-13 ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 1... 72 9e-11 ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citr... 72 2e-10 ref|XP_007009958.1| U-box domain-containing protein 14 [Theobrom... 70 6e-10 ref|XP_002311996.1| armadillo/beta-catenin repeat family protein... 70 6e-10 ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citr... 67 3e-09 ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 1... 67 3e-09 ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 1... 67 5e-09 ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 1... 66 6e-09 ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 1... 66 6e-09 ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [A... 66 8e-09 ref|XP_002315320.1| armadillo/beta-catenin repeat family protein... 66 8e-09 gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis] 64 2e-08 gb|AFK37700.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phas... 63 5e-08 ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 1... 63 5e-08 ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 1... 63 5e-08 ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 1... 63 7e-08 ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 1... 63 7e-08 ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus comm... 62 9e-08 >ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 14 [Vitis vinifera] Length = 628 Score = 80.9 bits (198), Expect = 3e-13 Identities = 42/63 (66%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = -3 Query: 183 EDSKEVIV--QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 10 +DS ++ V QL +V+EISG PECRNT KK Y NL RRVKLLSPLFEELKD E LE+ Sbjct: 5 KDSNKISVLNQLLAVVKEISGLPECRNTTKKMYYNLVRRVKLLSPLFEELKDSEEELEDS 64 Query: 9 EIR 1 EIR Sbjct: 65 EIR 67 >ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 631 Score = 72.4 bits (176), Expect = 9e-11 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = -3 Query: 183 EDSKEVIV-QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEE 7 E SK V++ +L E ++EISG PEC+N K+ Y NL RRVKLLSPLFEELKDG+ L +E+ Sbjct: 5 ESSKGVVMGRLVECIKEISGLPECQNLCKRVYGNLVRRVKLLSPLFEELKDGDESLSDEQ 64 Query: 6 IR 1 ++ Sbjct: 65 LQ 66 >ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gi|568864439|ref|XP_006485606.1| PREDICTED: U-box domain-containing protein 14-like [Citrus sinensis] gi|557538677|gb|ESR49721.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] Length = 627 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -3 Query: 171 EVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEIR 1 EV+ +L + V+E+SG PEC+N KK + NL RRVKLLSPLFEEL+DG L +EEI+ Sbjct: 9 EVLSRLVDSVKEVSGLPECKNFFKKMHGNLVRRVKLLSPLFEELRDGNEGLSQEEIK 65 >ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao] gi|508726871|gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao] Length = 637 Score = 69.7 bits (169), Expect = 6e-10 Identities = 36/63 (57%), Positives = 51/63 (80%), Gaps = 3/63 (4%) Frame = -3 Query: 180 DSK-EVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDG--EGVLEEE 10 DSK E++ QL E+V+EI+G P+C+N+ KK + NL RR+KLLSPLFEEL+DG E +++ E Sbjct: 8 DSKGELLSQLAELVKEITGLPDCKNSCKKTHGNLVRRIKLLSPLFEELRDGNEETMIKIE 67 Query: 9 EIR 1 EI+ Sbjct: 68 EIK 70 >ref|XP_002311996.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222851816|gb|EEE89363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 69.7 bits (169), Expect = 6e-10 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = -3 Query: 183 EDSKEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEI 4 + S E++ +L + V+EISG PECRN KK + +L RR+KLLSP+FEELKD L EEE Sbjct: 6 DPSSELLSRLVDSVKEISGLPECRNVFKKTHGDLVRRIKLLSPMFEELKDNNEELSEEET 65 Query: 3 R 1 + Sbjct: 66 K 66 >ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|568870221|ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis] gi|557526741|gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] Length = 661 Score = 67.4 bits (163), Expect = 3e-09 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 186 MEDSKEVIVQ-LFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 10 MED K V+VQ L + V EIS + R T+KKQYCNL+RR+KLL+P+FEE+K+ + + EE Sbjct: 1 MEDEKGVLVQSLIDTVNEISTISDYRGTVKKQYCNLARRLKLLTPMFEEIKESKEAIPEE 60 >ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14-like [Cicer arietinum] Length = 630 Score = 67.4 bits (163), Expect = 3e-09 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = -3 Query: 183 EDSKEVIV-QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEE 7 E+SK ++V +L + +R+ISG PEC+N K+ Y NL RRVKLLSPLFEELKD + L +++ Sbjct: 5 ENSKAMVVNRLADSIRDISGLPECQNVCKRMYGNLIRRVKLLSPLFEELKDSDESLCDQQ 64 Query: 6 IR 1 ++ Sbjct: 65 LQ 66 >ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 14-like [Fragaria vesca subsp. vesca] Length = 627 Score = 66.6 bits (161), Expect = 5e-09 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -3 Query: 174 KEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEI 4 K V+ QL + V+ IS PECRN +K Y N RRVKLLSPLFEEL+D + L EEE+ Sbjct: 10 KMVLSQLVDSVKAISELPECRNVFRKMYGNFVRRVKLLSPLFEELRDSDKQLGEEEV 66 >ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus] Length = 627 Score = 66.2 bits (160), Expect = 6e-09 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -3 Query: 168 VIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEIR 1 V+ QL E VREISG PEC KK Y +L RRVKLLSPLFEEL+DGE +E + ++ Sbjct: 9 VVNQLPESVREISGLPECNGICKKMYGDLIRRVKLLSPLFEELRDGEEEVELDVLK 64 >ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus] Length = 627 Score = 66.2 bits (160), Expect = 6e-09 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -3 Query: 168 VIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEIR 1 V+ QL E VREISG PEC KK Y +L RRVKLLSPLFEEL+DGE +E + ++ Sbjct: 9 VVNQLPESVREISGLPECNGICKKMYGDLIRRVKLLSPLFEELRDGEEEVELDVLK 64 >ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda] gi|548837860|gb|ERM98487.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda] Length = 630 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/60 (50%), Positives = 42/60 (70%) Frame = -3 Query: 183 EDSKEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEI 4 E+ ++++ L ++V+EIS PE RN +KQY NL RRVKLL PLFEELK+ L +E + Sbjct: 4 EEGEDIVQSLIDLVKEISELPEWRNPWRKQYYNLVRRVKLLGPLFEELKESSETLNDESV 63 >ref|XP_002315320.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222864360|gb|EEF01491.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 65.9 bits (159), Expect = 8e-09 Identities = 36/64 (56%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -3 Query: 189 LMED-SKEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEE 13 L ED + E++ L + V+EIS PECRN KK + NL RR+KLLSPLFEELKD L E Sbjct: 3 LTEDPNSELMSGLVDSVKEISMSPECRNVCKKMHGNLVRRIKLLSPLFEELKDNNEELSE 62 Query: 12 EEIR 1 EE + Sbjct: 63 EETK 66 >gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis] Length = 664 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/61 (45%), Positives = 45/61 (73%) Frame = -3 Query: 183 EDSKEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEEI 4 E S +++ L E+V EI+ E + T+KKQYCNL+RR+KLL+P+FEE++D + L +E + Sbjct: 4 EKSGDLVQSLIELVGEIASISEYKCTVKKQYCNLARRLKLLTPMFEEIRDSKEALPQETV 63 Query: 3 R 1 + Sbjct: 64 K 64 >gb|AFK37700.1| unknown [Lotus japonicus] Length = 94 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -3 Query: 183 EDSKEVIV-QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEE 7 E+ K +V L E ++EISG PEC+N K+ N+ RRVKLLSPLFEELKD + L +E+ Sbjct: 5 ENPKSAVVGSLVETIKEISGLPECQNVHKRMCGNMVRRVKLLSPLFEELKDSDESLSDEQ 64 Query: 6 I 4 + Sbjct: 65 L 65 >ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] gi|561016941|gb|ESW15745.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] Length = 631 Score = 63.2 bits (152), Expect = 5e-08 Identities = 32/61 (52%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -3 Query: 183 EDSKEVIV-QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEEE 7 E SK V++ +L E +++ISG EC+N ++ Y NL RRVKLLSPLFEELKD + L +E+ Sbjct: 5 ESSKGVVLGRLVECIKDISGLLECQNFCRRVYGNLIRRVKLLSPLFEELKDSDESLSDEQ 64 Query: 6 I 4 + Sbjct: 65 L 65 >ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 14-like isoform 2 [Solanum lycopersicum] Length = 586 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -3 Query: 174 KEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGV 22 +E+I +L E++ +SG PECR+ K+ Y NL RRVKLLSPL E+LKD +GV Sbjct: 6 EELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDSDGV 56 >ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 14-like isoform 1 [Solanum lycopersicum] Length = 624 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -3 Query: 174 KEVIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGV 22 +E+I +L E++ +SG PECR+ K+ Y NL RRVKLLSPL E+LKD +GV Sbjct: 6 EELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDSDGV 56 >ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 13-like [Fragaria vesca subsp. vesca] Length = 676 Score = 62.8 bits (151), Expect = 7e-08 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 2/64 (3%) Frame = -3 Query: 186 MEDSKEVIVQ-LFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKD-GEGVLEE 13 ME+ K +VQ L + V EI+ + R T+KKQYCNL+RR+KLL+P+FEE++D E V+ E Sbjct: 1 MEEDKGALVQSLIDTVNEIASISDYRCTVKKQYCNLARRLKLLTPMFEEIRDMKEAVVPE 60 Query: 12 EEIR 1 E ++ Sbjct: 61 ETVK 64 >ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 632 Score = 62.8 bits (151), Expect = 7e-08 Identities = 35/63 (55%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = -3 Query: 183 EDSKEVIV-QLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKD-GEGVLEEE 10 E SK V++ +L E ++EISG PE +N KK Y NL RRVKLLSPLFEELKD + L +E Sbjct: 5 ESSKGVVMSRLVECIKEISGLPESQNLCKKVYGNLVRRVKLLSPLFEELKDNSDESLSDE 64 Query: 9 EIR 1 +++ Sbjct: 65 QLQ 67 >ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus communis] gi|223525845|gb|EEF28280.1| Spotted leaf protein, putative [Ricinus communis] Length = 662 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/64 (45%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -3 Query: 186 MEDSKE--VIVQLFEIVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEE 13 MED ++ ++ L E V EI+ E R+T+KKQYCNL+RR+KLL P+FEE+K+ + ++E Sbjct: 1 MEDQEKGALVESLIETVNEIASISEYRSTVKKQYCNLARRLKLLIPMFEEIKESKEPIQE 60 Query: 12 EEIR 1 + + Sbjct: 61 QTFK 64