BLASTX nr result
ID: Akebia25_contig00030628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030628 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGX43646.1| hypothetical protein AOL_s00215g382 [Arthrobotrys... 60 3e-07 >gb|EGX43646.1| hypothetical protein AOL_s00215g382 [Arthrobotrys oligospora ATCC 24927] Length = 67 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Frame = -2 Query: 345 MPFSENTHVTYTDSSGKDVIGVVKGHSAGKYQIQIRSDIGSNDTHDIEEGKVKELKVDN- 169 M FSE THVT+T+S+G + +GVV+ HS G+Y IQ + + T + EG VKELKV + Sbjct: 1 MAFSEGTHVTFTNSTGGEEVGVVQSHSGGQYTIQRK----NGSTVTVSEGSVKELKVTSG 56 Query: 168 -PEACPV 151 + CPV Sbjct: 57 QKDNCPV 63