BLASTX nr result
ID: Akebia25_contig00030602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030602 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317465.1| tetratricopeptide repeat-containing family p... 87 2e-15 ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Popu... 86 7e-15 ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [A... 85 9e-15 ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 i... 84 2e-14 ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin... 84 2e-14 ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [S... 84 2e-14 ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin... 84 3e-14 ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818... 83 4e-14 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 83 5e-14 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 83 5e-14 gb|ACU18444.1| unknown [Glycine max] 83 5e-14 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 83 5e-14 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 82 6e-14 ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phas... 82 6e-14 ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] g... 82 6e-14 gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japo... 82 6e-14 gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] g... 82 8e-14 ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin... 82 8e-14 emb|CBI21978.3| unnamed protein product [Vitis vinifera] 82 8e-14 ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin... 82 8e-14 >ref|XP_002317465.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 87.0 bits (214), Expect = 2e-15 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVDVEE+ +ANAE+VRI+PT KIYKNG +VKE++CPSH VLE+SVRHY F Sbjct: 647 LKVDVEEHPAIANAEDVRIVPTFKIYKNGNRVKEIVCPSHDVLEHSVRHYSF 698 >ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] gi|550349347|gb|ERP66737.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] Length = 688 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVDVEEN ANAENVRI+PT KIYKNG +VKE++CPS +LE+SVRHY F Sbjct: 637 LKVDVEENPATANAENVRIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYSF 688 >ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] gi|548856039|gb|ERN13895.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] Length = 671 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 231 LKVD+ E+ VANAENVRI+PT KIYKNG +VKEMICP+ QVLEYSVRHY Sbjct: 620 LKVDINESPAVANAENVRIVPTFKIYKNGCRVKEMICPTEQVLEYSVRHY 669 >ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] gi|508721341|gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++E+ VANAENVRI+PT KIYKNG +VKE++CPS ++LE+SVRHY F Sbjct: 647 LKVDIDESPAVANAENVRIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYSF 698 >ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Setaria italica] Length = 677 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVDV E+ VA AENVR IPT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 626 LKVDVNESPAVARAENVRTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYG 676 >ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] gi|241929102|gb|EES02247.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] Length = 684 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVDV E+ VA AENVR IPT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 633 LKVDVNESPAVARAENVRTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYG 683 >ref|XP_004489036.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Cicer arietinum] Length = 691 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++EN TV AENVRI+PT KIYKNG +VKE++CPS +LE+SVRHY F Sbjct: 640 LKVDIQENPTVGTAENVRIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYSF 691 >ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818|gb|ACF78493.1| unknown [Zea mays] gi|413947748|gb|AFW80397.1| hypothetical protein ZEAMMB73_358491 [Zea mays] Length = 675 Score = 83.2 bits (204), Expect = 4e-14 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVDV E+ VA AENVR +PT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 624 LKVDVNESPAVARAENVRTVPTFKIYKNGIRVKEMICPSQQLLEYSVRHYG 674 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum lycopersicum] Length = 701 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 231 LKVDVEE+ ++ANAENVRI+PT KIYK G +VKEMICPS +VLE SVRHY Sbjct: 650 LKVDVEESPSIANAENVRIVPTFKIYKKGSRVKEMICPSQEVLESSVRHY 699 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] Length = 692 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++++ TVA AENVRI+PT KIYKNG ++KE++CPSH +LE+SVRHY F Sbjct: 641 LKVDIQQSPTVATAENVRIVPTFKIYKNGCRLKEIVCPSHDMLEHSVRHYSF 692 >gb|ACU18444.1| unknown [Glycine max] Length = 377 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++++ TVA AENVRI+PT KIYKNG ++KE++CPSH +LE+SVRHY F Sbjct: 326 LKVDIQQSPTVATAENVRIVPTFKIYKNGCRLKEIVCPSHDMLEHSVRHYSF 377 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 82.8 bits (203), Expect = 5e-14 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD+ + VANAEN+RI+PT KIYKNG +VKE++CPSH +LE+SVRHY F Sbjct: 589 LKVDIGNSPAVANAENIRIVPTFKIYKNGSRVKEIVCPSHDMLEHSVRHYSF 640 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 231 LKVDVEE+ +ANAENVRI+PT KIYK G +VKEMICPS +VLE SVRHY Sbjct: 649 LKVDVEESPAIANAENVRIVPTFKIYKKGSRVKEMICPSQEVLESSVRHY 698 >ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] gi|561022663|gb|ESW21393.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] Length = 688 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++E+ TV AENVRI+PT KIYKNG +VKE++CPS ++LE+SVRHY F Sbjct: 637 LKVDIQESPTVGTAENVRIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYSF 688 >ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] gi|56201618|dbj|BAD73065.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|56784083|dbj|BAD81412.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|113531941|dbj|BAF04324.1| Os01g0218200 [Oryza sativa Japonica Group] Length = 672 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVD+ E+ VA AENVR +PT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 621 LKVDISESPAVARAENVRTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYG 671 >gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japonica Group] Length = 473 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVD+ E+ VA AENVR +PT KIYKNG +VKEMICPS Q+LEYSVRHYG Sbjct: 422 LKVDISESPAVARAENVRTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYG 472 >gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] gi|414875705|tpg|DAA52836.1| TPA: hypothetical protein ZEAMMB73_661523 [Zea mays] Length = 670 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYG 228 LKVDV E+ VA AENVR IPT KIYKNG +VKEMICPS Q+LEYSVRH+G Sbjct: 619 LKVDVNESPAVARAENVRTIPTFKIYKNGIRVKEMICPSQQLLEYSVRHFG 669 >ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 698 Score = 82.0 bits (201), Expect = 8e-14 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHYGF 225 LKVD++++ TVA AENVRI+PT KIYKNG +VKE++CPS +LE+SVRHY F Sbjct: 647 LKVDIQQSPTVATAENVRIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYSF 698 >emb|CBI21978.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 231 LKVDVEE+ VA AE+++ +PT KIYKNGGKV EMICPSHQ LEYSVR+Y Sbjct: 624 LKVDVEESPAVAKAESIKSVPTFKIYKNGGKVNEMICPSHQYLEYSVRYY 673 >ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 710 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -1 Query: 380 LKVDVEENTTVANAENVRIIPTLKIYKNGGKVKEMICPSHQVLEYSVRHY 231 LKVDVEE+ VA AE+++ +PT KIYKNGGKV EMICPSHQ LEYSVR+Y Sbjct: 659 LKVDVEESPAVAKAESIKSVPTFKIYKNGGKVNEMICPSHQYLEYSVRYY 708