BLASTX nr result
ID: Akebia25_contig00030578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030578 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530964.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002530964.1| conserved hypothetical protein [Ricinus communis] gi|223529479|gb|EEF31436.1| conserved hypothetical protein [Ricinus communis] Length = 530 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 1/101 (0%) Frame = -1 Query: 394 EHNKDISDLS-PLISVPSTIPSKVSENYVTTDQMVLEDDVHDGIQNDRKSLVLGHPDVSQ 218 E+N D+ ++ S +++P + E D++ D++ D I + L+L PD S Sbjct: 18 ENNVDVPEVFYHETSESASVPQQSLEYESKADEVDFIDNILDKIVYEDSRLILKGPDYSA 77 Query: 217 ESSGTKVTGEEFSEVAEGIKEIDERLLIELDAVGDFNVDEL 95 E+ + V E ++ + IKEIDE LL ELD VGDF V E+ Sbjct: 78 EAHRSSVVEENINQDEDEIKEIDEGLLSELDTVGDFRVKEV 118