BLASTX nr result
ID: Akebia25_contig00030299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030299 (756 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018996.1| S-locus lectin protein kinase family protein... 58 4e-06 >ref|XP_007018996.1| S-locus lectin protein kinase family protein [Theobroma cacao] gi|508724324|gb|EOY16221.1| S-locus lectin protein kinase family protein [Theobroma cacao] Length = 1213 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +3 Query: 24 QGGWNSTVVDIWDWERESKIWEVRENMERWAQRVQ 128 Q G ST WDWERESKIWEVRE MERWA +VQ Sbjct: 1166 QAGKESTCEGTWDWERESKIWEVREEMERWAAKVQ 1200