BLASTX nr result
ID: Akebia25_contig00030252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00030252 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 60 4e-07 gb|ACF74281.1| electron transporter/thiol-disulfide exchange int... 60 4e-07 emb|CBI37229.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 59 5e-07 ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 59 5e-07 ref|NP_001238538.1| uncharacterized protein LOC100305906 [Glycin... 59 7e-07 gb|AFK37707.1| unknown [Lotus japonicus] 59 9e-07 ref|XP_004140671.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 58 2e-06 ref|XP_002869477.1| hypothetical protein ARALYDRAFT_491884 [Arab... 58 2e-06 ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic is... 57 3e-06 ref|XP_006443692.1| hypothetical protein CICLE_v10022530mg [Citr... 57 3e-06 ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citr... 57 3e-06 ref|XP_006412917.1| hypothetical protein EUTSA_v10026359mg [Eutr... 57 3e-06 ref|XP_002303098.2| glutaredoxin family protein [Populus trichoc... 57 3e-06 ref|XP_007050085.1| Glutaredoxin family protein isoform 1 [Theob... 57 3e-06 ref|XP_007144429.1| hypothetical protein PHAVU_007G155300g [Phas... 56 5e-06 ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prun... 55 8e-06 ref|XP_004168592.1| PREDICTED: glutaredoxin-C5, chloroplastic-li... 55 8e-06 ref|NP_194602.2| glutaredoxin-C5 [Arabidopsis thaliana] gi|75151... 55 8e-06 pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutare... 55 8e-06 >ref|XP_002267052.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Vitis vinifera] Length = 178 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = +2 Query: 14 FVIEYS--GPQGPQLQKVLERLTGQHTVPNVFIG 109 FVIE GPQGPQLQKVLERLTGQHTVPNVFIG Sbjct: 112 FVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIG 145 >gb|ACF74281.1| electron transporter/thiol-disulfide exchange intermediate protein [Arachis hypogaea] Length = 187 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 14 FVIEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 F ++ GPQGPQLQKVLERLTGQHTVPNVFIG Sbjct: 124 FELDEMGPQGPQLQKVLERLTGQHTVPNVFIG 155 >emb|CBI37229.3| unnamed protein product [Vitis vinifera] Length = 114 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = +2 Query: 14 FVIEYS--GPQGPQLQKVLERLTGQHTVPNVFIG 109 FVIE GPQGPQLQKVLERLTGQHTVPNVFIG Sbjct: 48 FVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIG 81 >ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum tuberosum] Length = 183 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFIGVTDYG 124 ++ GPQGPQLQKVLERLTGQHTVPNVFIG G Sbjct: 121 LDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHIG 155 >ref|XP_004242377.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum lycopersicum] Length = 183 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFIGVTDYG 124 ++ GPQGPQLQKVLERLTGQHTVPNVFIG G Sbjct: 121 LDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHIG 155 >ref|NP_001238538.1| uncharacterized protein LOC100305906 [Glycine max] gi|255626941|gb|ACU13815.1| unknown [Glycine max] Length = 166 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 14 FVIEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 F ++ GPQGPQLQKVLER+TGQHTVPNVFIG Sbjct: 102 FELDEMGPQGPQLQKVLERITGQHTVPNVFIG 133 >gb|AFK37707.1| unknown [Lotus japonicus] Length = 182 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +2 Query: 14 FVIEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 F ++ GPQGPQLQK+LERLTGQHTVPNVFIG Sbjct: 118 FELDEMGPQGPQLQKMLERLTGQHTVPNVFIG 149 >ref|XP_004140671.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Cucumis sativus] Length = 120 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 32 GPQGPQLQKVLERLTGQHTVPNVFIG 109 GPQGPQLQKVLERLTGQHTVPNVFIG Sbjct: 62 GPQGPQLQKVLERLTGQHTVPNVFIG 87 >ref|XP_002869477.1| hypothetical protein ARALYDRAFT_491884 [Arabidopsis lyrata subsp. lyrata] gi|297315313|gb|EFH45736.1| hypothetical protein ARALYDRAFT_491884 [Arabidopsis lyrata subsp. lyrata] Length = 177 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 ++ GPQGPQLQKVLERLTGQHTVPNVF+G Sbjct: 115 LDQLGPQGPQLQKVLERLTGQHTVPNVFVG 144 >ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic isoform X1 [Glycine max] Length = 177 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 14 FVIEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 F ++ GPQGPQL KVLER+TGQHTVPNVFIG Sbjct: 113 FELDEMGPQGPQLHKVLERITGQHTVPNVFIG 144 >ref|XP_006443692.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545954|gb|ESR56932.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] Length = 144 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 ++ GPQGPQLQK+LERLTGQHTVPNVFIG Sbjct: 114 LDEMGPQGPQLQKLLERLTGQHTVPNVFIG 143 >ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902404|ref|XP_006443690.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|567902406|ref|XP_006443691.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|568853006|ref|XP_006480159.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X1 [Citrus sinensis] gi|557545951|gb|ESR56929.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545952|gb|ESR56930.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] gi|557545953|gb|ESR56931.1| hypothetical protein CICLE_v10022530mg [Citrus clementina] Length = 174 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 ++ GPQGPQLQK+LERLTGQHTVPNVFIG Sbjct: 114 LDEMGPQGPQLQKLLERLTGQHTVPNVFIG 143 >ref|XP_006412917.1| hypothetical protein EUTSA_v10026359mg [Eutrema salsugineum] gi|557114087|gb|ESQ54370.1| hypothetical protein EUTSA_v10026359mg [Eutrema salsugineum] Length = 180 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 32 GPQGPQLQKVLERLTGQHTVPNVFIG 109 GPQGPQLQKVLERLTGQHTVPN+F+G Sbjct: 122 GPQGPQLQKVLERLTGQHTVPNIFVG 147 >ref|XP_002303098.2| glutaredoxin family protein [Populus trichocarpa] gi|550345808|gb|EEE82371.2| glutaredoxin family protein [Populus trichocarpa] Length = 183 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 32 GPQGPQLQKVLERLTGQHTVPNVFIGVTDY 121 G QGPQ+QKVLERLTGQHTVPNVFI +DY Sbjct: 127 GAQGPQIQKVLERLTGQHTVPNVFIAFSDY 156 >ref|XP_007050085.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|590715051|ref|XP_007050086.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|508702346|gb|EOX94242.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gi|508702347|gb|EOX94243.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] Length = 175 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 32 GPQGPQLQKVLERLTGQHTVPNVFIG 109 GPQGPQ+QKVLERLTGQHTVPNVFIG Sbjct: 117 GPQGPQVQKVLERLTGQHTVPNVFIG 142 >ref|XP_007144429.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris] gi|561017619|gb|ESW16423.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris] Length = 226 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 14 FVIEYSGPQGPQLQKVLERLTGQHTVPNVFIG 109 F ++ GPQGPQLQK LER+TGQHTVPNVFIG Sbjct: 162 FELDEMGPQGPQLQKGLERITGQHTVPNVFIG 193 >ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] gi|462396804|gb|EMJ02603.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica] Length = 178 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 32 GPQGPQLQKVLERLTGQHTVPNVFI 106 GPQGPQLQKVLERLTGQHTVPNVFI Sbjct: 120 GPQGPQLQKVLERLTGQHTVPNVFI 144 >ref|XP_004168592.1| PREDICTED: glutaredoxin-C5, chloroplastic-like, partial [Cucumis sativus] Length = 58 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 35 PQGPQLQKVLERLTGQHTVPNVFIG 109 PQGPQLQKVLERLTGQHTVPNVFIG Sbjct: 1 PQGPQLQKVLERLTGQHTVPNVFIG 25 >ref|NP_194602.2| glutaredoxin-C5 [Arabidopsis thaliana] gi|75151040|sp|Q8GWS0.1|GRXC5_ARATH RecName: Full=Glutaredoxin-C5, chloroplastic; Short=AtGrxC5; Flags: Precursor gi|26452363|dbj|BAC43267.1| unknown protein [Arabidopsis thaliana] gi|28372898|gb|AAO39931.1| At4g28730 [Arabidopsis thaliana] gi|332660135|gb|AEE85535.1| glutaredoxin-C5 [Arabidopsis thaliana] Length = 174 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFI 106 ++ GPQGPQLQKVLERLTGQHTVPNVF+ Sbjct: 112 LDQLGPQGPQLQKVLERLTGQHTVPNVFV 140 >pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5 From Arabidopsis Thaliana gi|334359526|pdb|3RHC|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C5 From Arabidopsis Thaliana gi|334359527|pdb|3RHC|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C5 From Arabidopsis Thaliana Length = 113 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 20 IEYSGPQGPQLQKVLERLTGQHTVPNVFI 106 ++ GPQGPQLQKVLERLTGQHTVPNVF+ Sbjct: 51 LDQLGPQGPQLQKVLERLTGQHTVPNVFV 79