BLASTX nr result
ID: Akebia25_contig00029865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00029865 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001797984.1| hypothetical protein SNOG_07651 [Phaeosphaer... 226 3e-57 gb|EON68014.1| V-type proton ATPase subunit B [Coniosporium apol... 225 6e-57 gb|EOA90780.1| hypothetical protein SETTUDRAFT_166678 [Setosphae... 223 3e-56 gb|EMD69315.1| hypothetical protein COCSADRAFT_105685 [Bipolaris... 223 3e-56 ref|XP_003301280.1| hypothetical protein PTT_12738 [Pyrenophora ... 223 3e-56 gb|EER41722.1| vacuolar ATP synthase subunit B [Ajellomyces caps... 223 3e-56 ref|XP_001936427.1| vacuolar ATP synthase subunit B [Pyrenophora... 223 3e-56 ref|XP_001538346.1| vacuolar ATP synthase subunit B [Ajellomyces... 223 3e-56 ref|XP_003836939.1| similar to V-type proton ATPase subunit B [L... 221 8e-56 ref|XP_002626135.1| V-type ATPase B subunit [Ajellomyces dermati... 221 8e-56 gb|EGE02775.1| vacuolar ATP synthase subunit B [Trichophyton equ... 221 1e-55 gb|EGD93716.1| vacuolar ATP synthase subunit B [Trichophyton ton... 221 1e-55 ref|XP_003174781.1| vacuolar ATP synthase subunit B [Arthroderma... 221 1e-55 ref|XP_003016517.1| hypothetical protein ARB_04806 [Arthroderma ... 221 1e-55 gb|EZF16008.1| V-type proton ATPase subunit B [Trichophyton rubr... 220 1e-55 gb|EZF16007.1| V-type proton ATPase subunit B [Trichophyton rubr... 220 1e-55 ref|XP_007587424.1| putative vacuolar atp synthase subunit b pro... 220 1e-55 gb|EKG17928.1| hypothetical protein MPH_04877 [Macrophomina phas... 220 1e-55 ref|XP_003236513.1| vacuolar ATP synthase subunit B [Trichophyto... 220 1e-55 dbj|GAD93413.1| vacuolar ATP synthase subunit B [Byssochlamys sp... 220 2e-55 >ref|XP_001797984.1| hypothetical protein SNOG_07651 [Phaeosphaeria nodorum SN15] gi|111063997|gb|EAT85117.1| hypothetical protein SNOG_07651 [Phaeosphaeria nodorum SN15] Length = 508 Score = 226 bits (575), Expect = 3e-57 Identities = 110/115 (95%), Positives = 114/115 (99%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQASLV KPTKGVHDGH+DNFSIVFGAMGVNLETSRFFT+DFEE Sbjct: 163 FSSSGLPHNEIAAQICRQASLVGKPTKGVHDGHDDNFSIVFGAMGVNLETSRFFTKDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >gb|EON68014.1| V-type proton ATPase subunit B [Coniosporium apollinis CBS 100218] Length = 518 Score = 225 bits (573), Expect = 6e-57 Identities = 110/115 (95%), Positives = 113/115 (98%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQA LV KPTKGVHDGHE+NFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 165 FSAAGLPHNEIAAQICRQAGLVGKPTKGVHDGHEENFSIVFGAMGVNLETSRFFTRDFEE 224 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 225 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 279 >gb|EOA90780.1| hypothetical protein SETTUDRAFT_166678 [Setosphaeria turcica Et28A] Length = 510 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQA LV KPTKGVHD H+DNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 163 FSSSGLPHNEIAAQICRQAGLVGKPTKGVHDDHDDNFSIVFGAMGVNLETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >gb|EMD69315.1| hypothetical protein COCSADRAFT_105685 [Bipolaris sorokiniana ND90Pr] gi|452003492|gb|EMD95949.1| hypothetical protein COCHEDRAFT_1191101 [Bipolaris maydis C5] gi|477593739|gb|ENI10808.1| hypothetical protein COCC4DRAFT_46462 [Bipolaris maydis ATCC 48331] gi|576921771|gb|EUC35907.1| hypothetical protein COCCADRAFT_34633 [Bipolaris zeicola 26-R-13] gi|576936928|gb|EUC50419.1| hypothetical protein COCMIDRAFT_82054 [Bipolaris oryzae ATCC 44560] gi|578493214|gb|EUN30608.1| hypothetical protein COCVIDRAFT_89818 [Bipolaris victoriae FI3] Length = 510 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQA LV KPTKGVHD H+DNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 163 FSSSGLPHNEIAAQICRQAGLVGKPTKGVHDDHDDNFSIVFGAMGVNLETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >ref|XP_003301280.1| hypothetical protein PTT_12738 [Pyrenophora teres f. teres 0-1] gi|311324131|gb|EFQ90625.1| hypothetical protein PTT_12738 [Pyrenophora teres f. teres 0-1] Length = 510 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQA LV KPTKGVHD H+DNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 163 FSSSGLPHNEIAAQICRQAGLVGKPTKGVHDDHDDNFSIVFGAMGVNLETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >gb|EER41722.1| vacuolar ATP synthase subunit B [Ajellomyces capsulatus H143] gi|325096275|gb|EGC49585.1| vacuolar ATP synthase subunit B [Ajellomyces capsulatus H88] Length = 504 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 113/115 (98%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQASLVSKPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSAAGLPHNEIAAQICRQASLVSKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >ref|XP_001936427.1| vacuolar ATP synthase subunit B [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983526|gb|EDU49014.1| vacuolar ATP synthase subunit B [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 510 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQA LV KPTKGVHD H+DNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 163 FSSSGLPHNEIAAQICRQAGLVGKPTKGVHDDHDDNFSIVFGAMGVNLETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >ref|XP_001538346.1| vacuolar ATP synthase subunit B [Ajellomyces capsulatus NAm1] gi|150414786|gb|EDN10148.1| vacuolar ATP synthase subunit B [Ajellomyces capsulatus NAm1] Length = 508 Score = 223 bits (567), Expect = 3e-56 Identities = 109/115 (94%), Positives = 113/115 (98%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQASLVSKPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 168 FSAAGLPHNEIAAQICRQASLVSKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 227 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 228 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 282 >ref|XP_003836939.1| similar to V-type proton ATPase subunit B [Leptosphaeria maculans JN3] gi|312213492|emb|CBX93574.1| similar to V-type proton ATPase subunit B [Leptosphaeria maculans JN3] Length = 581 Score = 221 bits (563), Expect = 8e-56 Identities = 108/115 (93%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FS+SGLPHNEIAAQICRQA LV KP+KGVHD H+DNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 235 FSSSGLPHNEIAAQICRQAGLVGKPSKGVHDDHDDNFSIVFGAMGVNLETSRFFTRDFEE 294 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 295 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 349 >ref|XP_002626135.1| V-type ATPase B subunit [Ajellomyces dermatitidis SLH14081] gi|239594343|gb|EEQ76924.1| V-type ATPase B subunit [Ajellomyces dermatitidis SLH14081] gi|239615508|gb|EEQ92495.1| V-type ATPase B subunit [Ajellomyces dermatitidis ER-3] gi|327358080|gb|EGE86937.1| vacuolar ATP synthase subunit B [Ajellomyces dermatitidis ATCC 18188] gi|531980993|gb|EQL31580.1| V-type proton ATPase subunit B [Ajellomyces dermatitidis ATCC 26199] Length = 504 Score = 221 bits (563), Expect = 8e-56 Identities = 108/115 (93%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQASLV KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSAAGLPHNEIAAQICRQASLVGKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >gb|EGE02775.1| vacuolar ATP synthase subunit B [Trichophyton equinum CBS 127.97] gi|607896272|gb|EZF34810.1| V-type proton ATPase subunit B [Trichophyton interdigitale H6] Length = 508 Score = 221 bits (562), Expect = 1e-55 Identities = 108/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSASGLPHNEIAAQICRQAGLVKKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >gb|EGD93716.1| vacuolar ATP synthase subunit B [Trichophyton tonsurans CBS 112818] Length = 508 Score = 221 bits (562), Expect = 1e-55 Identities = 108/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSASGLPHNEIAAQICRQAGLVKKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >ref|XP_003174781.1| vacuolar ATP synthase subunit B [Arthroderma gypseum CBS 118893] gi|311340096|gb|EFQ99298.1| vacuolar ATP synthase subunit B [Arthroderma gypseum CBS 118893] Length = 509 Score = 221 bits (562), Expect = 1e-55 Identities = 108/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSASGLPHNEIAAQICRQAGLVKKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >ref|XP_003016517.1| hypothetical protein ARB_04806 [Arthroderma benhamiae CBS 112371] gi|302660842|ref|XP_003022096.1| hypothetical protein TRV_03783 [Trichophyton verrucosum HKI 0517] gi|291180087|gb|EFE35872.1| hypothetical protein ARB_04806 [Arthroderma benhamiae CBS 112371] gi|291186024|gb|EFE41478.1| hypothetical protein TRV_03783 [Trichophyton verrucosum HKI 0517] Length = 418 Score = 221 bits (562), Expect = 1e-55 Identities = 108/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 74 FSASGLPHNEIAAQICRQAGLVKKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 133 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 134 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 188 >gb|EZF16008.1| V-type proton ATPase subunit B [Trichophyton rubrum MR850] gi|607902574|gb|EZF40137.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 100081] gi|607914690|gb|EZF50766.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914691|gb|EZF50767.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914692|gb|EZF50768.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914693|gb|EZF50769.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914694|gb|EZF50770.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607926718|gb|EZF61367.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 289.86] gi|607938692|gb|EZF72024.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938693|gb|EZF72025.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938694|gb|EZF72026.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938695|gb|EZF72027.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938696|gb|EZF72028.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607950692|gb|EZF82678.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950693|gb|EZF82679.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950694|gb|EZF82680.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950695|gb|EZF82681.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950696|gb|EZF82682.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607962863|gb|EZF93376.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1459] gi|607975602|gb|EZG04832.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 735.88] gi|607986811|gb|EZG14886.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986812|gb|EZG14887.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986813|gb|EZG14888.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986814|gb|EZG14889.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986815|gb|EZG14890.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] Length = 368 Score = 220 bits (561), Expect = 1e-55 Identities = 107/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK +HDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 24 FSASGLPHNEIAAQICRQAGLVKKPTKDIHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 83 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 84 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 138 >gb|EZF16007.1| V-type proton ATPase subunit B [Trichophyton rubrum MR850] gi|607902573|gb|EZF40136.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 100081] gi|607914685|gb|EZF50761.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914686|gb|EZF50762.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914687|gb|EZF50763.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914688|gb|EZF50764.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607914689|gb|EZF50765.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607926717|gb|EZF61366.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 289.86] gi|607938687|gb|EZF72019.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938688|gb|EZF72020.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938689|gb|EZF72021.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938690|gb|EZF72022.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607938691|gb|EZF72023.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607950687|gb|EZF82673.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950688|gb|EZF82674.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950689|gb|EZF82675.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950690|gb|EZF82676.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607950691|gb|EZF82677.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607962862|gb|EZF93375.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1459] gi|607975601|gb|EZG04831.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 735.88] gi|607986806|gb|EZG14881.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986807|gb|EZG14882.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986808|gb|EZG14883.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986809|gb|EZG14884.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] gi|607986810|gb|EZG14885.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] Length = 418 Score = 220 bits (561), Expect = 1e-55 Identities = 107/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK +HDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 74 FSASGLPHNEIAAQICRQAGLVKKPTKDIHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 133 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 134 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 188 >ref|XP_007587424.1| putative vacuolar atp synthase subunit b protein [Neofusicoccum parvum UCRNP2] gi|485918420|gb|EOD45084.1| putative vacuolar atp synthase subunit b protein [Neofusicoccum parvum UCRNP2] Length = 516 Score = 220 bits (561), Expect = 1e-55 Identities = 110/115 (95%), Positives = 113/115 (98%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQASLV KPTKG+HD HEDNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 164 FSAAGLPHNEIAAQICRQASLV-KPTKGIHDDHEDNFSIVFGAMGVNLETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 277 >gb|EKG17928.1| hypothetical protein MPH_04877 [Macrophomina phaseolina MS6] Length = 385 Score = 220 bits (561), Expect = 1e-55 Identities = 110/115 (95%), Positives = 113/115 (98%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQASLV KPTKG+HD HEDNFSIVFGAMGVNLETSRFFTRDFEE Sbjct: 33 FSAAGLPHNEIAAQICRQASLV-KPTKGIHDDHEDNFSIVFGAMGVNLETSRFFTRDFEE 91 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLSSYCD Sbjct: 92 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSSYCD 146 >ref|XP_003236513.1| vacuolar ATP synthase subunit B [Trichophyton rubrum CBS 118892] gi|326461855|gb|EGD87308.1| vacuolar ATP synthase subunit B [Trichophyton rubrum CBS 118892] gi|607870765|gb|EZF16006.1| V-type proton ATPase subunit B [Trichophyton rubrum MR850] gi|607902572|gb|EZF40135.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 100081] gi|607914684|gb|EZF50760.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 288.86] gi|607926716|gb|EZF61365.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 289.86] gi|607938686|gb|EZF72018.1| V-type proton ATPase subunit B [Trichophyton soudanense CBS 452.61] gi|607950686|gb|EZF82672.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1448] gi|607962861|gb|EZF93374.1| V-type proton ATPase subunit B [Trichophyton rubrum MR1459] gi|607975600|gb|EZG04830.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 735.88] gi|607986805|gb|EZG14880.1| V-type proton ATPase subunit B [Trichophyton rubrum CBS 202.88] Length = 508 Score = 220 bits (561), Expect = 1e-55 Identities = 107/115 (93%), Positives = 111/115 (96%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSASGLPHNEIAAQICRQA LV KPTK +HDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 164 FSASGLPHNEIAAQICRQAGLVKKPTKDIHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 223 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 224 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 278 >dbj|GAD93413.1| vacuolar ATP synthase subunit B [Byssochlamys spectabilis No. 5] Length = 508 Score = 220 bits (560), Expect = 2e-55 Identities = 107/115 (93%), Positives = 112/115 (97%) Frame = -1 Query: 346 FSASGLPHNEIAAQICRQASLVSKPTKGVHDGHEDNFSIVFGAMGVNLETSRFFTRDFEE 167 FSA+GLPHNEIAAQICRQA LV+KPTK VHDGHEDNFSIVF AMGVN+ETSRFFTRDFEE Sbjct: 163 FSAAGLPHNEIAAQICRQAGLVNKPTKDVHDGHEDNFSIVFAAMGVNMETSRFFTRDFEE 222 Query: 166 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYFAYQLEKHVLVILTDLSSYCD 2 NGSMERVTLFLNLANDPTIERIITPRLALTTAEY+AYQLEKHVLVILTDLS+YCD Sbjct: 223 NGSMERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCD 277