BLASTX nr result
ID: Akebia25_contig00029779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00029779 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI47520.1| iron-sulfer cluster scaffold protein NFU4 [Eucaly... 58 2e-06 gb|AFW81446.1| hypothetical protein ZEAMMB73_536097 [Zea mays] 57 3e-06 gb|AFW81445.1| hypothetical protein ZEAMMB73_536097 [Zea mays] 57 3e-06 gb|AFW81444.1| hypothetical protein ZEAMMB73_536097 [Zea mays] 57 3e-06 ref|XP_003568893.1| PREDICTED: nifU-like protein 4, mitochondria... 57 3e-06 ref|XP_002439319.1| hypothetical protein SORBIDRAFT_09g004310 [S... 57 3e-06 ref|NP_001131382.2| uncharacterized protein LOC100192708 [Zea ma... 57 3e-06 ref|XP_007010346.1| NFU domain protein 4 isoform 3 [Theobroma ca... 57 4e-06 ref|XP_007010345.1| NFU domain protein 4 isoform 2 [Theobroma ca... 57 4e-06 ref|XP_007010344.1| NFU domain protein 4 isoform 1 [Theobroma ca... 57 4e-06 gb|EMT19813.1| NifU-like protein 4, mitochondrial [Aegilops taus... 57 4e-06 gb|EMS47220.1| NifU-like protein 4, mitochondrial [Triticum urartu] 57 4e-06 dbj|BAJ94768.1| predicted protein [Hordeum vulgare subsp. vulgar... 57 4e-06 emb|CBI35250.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002264979.1| PREDICTED: nifU-like protein 4, mitochondria... 56 5e-06 ref|XP_004977073.1| PREDICTED: nifU-like protein 4, mitochondria... 56 6e-06 ref|XP_004977072.1| PREDICTED: nifU-like protein 4, mitochondria... 56 6e-06 >gb|ACI47520.1| iron-sulfer cluster scaffold protein NFU4 [Eucalyptus grandis] Length = 243 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS L K EIFA IMDFY+SGQPLFLD S MDTAIHE Sbjct: 100 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLFLDSQTASAMDTAIHE 147 >gb|AFW81446.1| hypothetical protein ZEAMMB73_536097 [Zea mays] Length = 213 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAAASMDTAIHE 178 >gb|AFW81445.1| hypothetical protein ZEAMMB73_536097 [Zea mays] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAAASMDTAIHE 178 >gb|AFW81444.1| hypothetical protein ZEAMMB73_536097 [Zea mays] Length = 276 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAAASMDTAIHE 178 >ref|XP_003568893.1| PREDICTED: nifU-like protein 4, mitochondrial-like [Brachypodium distachyon] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS K EIFA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 128 VTVTKSDETSWDYLKPEIFAAIMDFYSSGQPLFLDSNTAAAMDTAIHE 175 >ref|XP_002439319.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor] gi|241944604|gb|EES17749.1| hypothetical protein SORBIDRAFT_09g004310 [Sorghum bicolor] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 131 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQPLFLDSNAAASMDTAIHE 178 >ref|NP_001131382.2| uncharacterized protein LOC100192708 [Zea mays] gi|238908578|gb|ACF79773.2| unknown [Zea mays] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 131 VTVTKSEETSWDCLKPEVFAAIMDFYSSGQPLFLDSNAAASMDTAIHE 178 >ref|XP_007010346.1| NFU domain protein 4 isoform 3 [Theobroma cacao] gi|508727259|gb|EOY19156.1| NFU domain protein 4 isoform 3 [Theobroma cacao] Length = 260 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS L K EIFA IMDFY+SGQPLFLD + MDTAIHE Sbjct: 139 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLFLDSKTAAAMDTAIHE 186 >ref|XP_007010345.1| NFU domain protein 4 isoform 2 [Theobroma cacao] gi|508727258|gb|EOY19155.1| NFU domain protein 4 isoform 2 [Theobroma cacao] Length = 273 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS L K EIFA IMDFY+SGQPLFLD + MDTAIHE Sbjct: 139 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLFLDSKTAAAMDTAIHE 186 >ref|XP_007010344.1| NFU domain protein 4 isoform 1 [Theobroma cacao] gi|508727257|gb|EOY19154.1| NFU domain protein 4 isoform 1 [Theobroma cacao] Length = 280 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS L K EIFA IMDFY+SGQPLFLD + MDTAIHE Sbjct: 139 VTVTKSDDASWDLLKPEIFAAIMDFYSSGQPLFLDSKTAAAMDTAIHE 186 >gb|EMT19813.1| NifU-like protein 4, mitochondrial [Aegilops tauschii] Length = 266 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 126 VTVTKSDETSWDYLKPEVFAAIMDFYSSGQPLFLDSNTAAAMDTAIHE 173 >gb|EMS47220.1| NifU-like protein 4, mitochondrial [Triticum urartu] Length = 252 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 101 VTVTKSDETSWDYLKPEVFAAIMDFYSSGQPLFLDSNTAAAMDTAIHE 148 >dbj|BAJ94768.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326521670|dbj|BAK00411.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 268 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS K E+FA IMDFY+SGQPLFLD N + MDTAIHE Sbjct: 128 VTVTKSDETSWDYLKPEVFAAIMDFYSSGQPLFLDSNTAAAMDTAIHE 175 >emb|CBI35250.3| unnamed protein product [Vitis vinifera] Length = 202 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 I TKS K EIFA IMDFY+SG+PLFLD N + MDTAIHE Sbjct: 61 ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTAAAMDTAIHE 108 >ref|XP_002264979.1| PREDICTED: nifU-like protein 4, mitochondrial-like [Vitis vinifera] Length = 271 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 I TKS K EIFA IMDFY+SG+PLFLD N + MDTAIHE Sbjct: 130 ITVTKSDDASWDFIKPEIFAAIMDFYSSGKPLFLDSNTAAAMDTAIHE 177 >ref|XP_004977073.1| PREDICTED: nifU-like protein 4, mitochondrial-like isoform X2 [Setaria italica] Length = 272 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQP+FLD N + MDTAIHE Sbjct: 132 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQPIFLDSNVAASMDTAIHE 179 >ref|XP_004977072.1| PREDICTED: nifU-like protein 4, mitochondrial-like isoform X1 [Setaria italica] Length = 273 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -3 Query: 145 INFTKSKIRFLGLSKTEIFATIMDFYASGQPLFLDYNDVSFMDTAIHE 2 + TKS+ K E+FA IMDFY+SGQP+FLD N + MDTAIHE Sbjct: 133 VTVTKSEETSWDYLKPEVFAAIMDFYSSGQPIFLDSNVAASMDTAIHE 180