BLASTX nr result
ID: Akebia25_contig00029694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00029694 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P49352.1|FPPS2_LUPAL RecName: Full=Farnesyl pyrophosphate syn... 83 4e-14 gb|EYU33721.1| hypothetical protein MIMGU_mgv1a008270mg [Mimulus... 82 8e-14 ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifer... 82 8e-14 emb|CBI39786.3| unnamed protein product [Vitis vinifera] 82 8e-14 gb|AGS79228.1| farnesyl diphosphate synthase [Panax notoginseng] 82 1e-13 gb|AAY87903.1| farnesyl diphosphate synthase [Panax ginseng] 82 1e-13 gb|AFO67222.1| putative farnesyl diphosphate synthase, partial [... 82 1e-13 gb|ADJ68004.1| farnesyl diphosphate synthase [Panax quinquefoliu... 82 1e-13 gb|ADK12004.1| farnesyl diphosphate synthase [Aralia elata] 82 1e-13 gb|AAY53905.1| farnesyl pyrophosphate synthase [Panax notoginseng] 82 1e-13 gb|AEG47693.1| farnesyl diphosphate synthase [Allium sativum] 81 2e-13 gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] 80 2e-13 gb|ADV03080.1| farnesyl diphosphate synthase [Bacopa monnieri] 80 3e-13 gb|ABV08819.1| farnesyl diphosphate synthetase [Salvia miltiorrh... 80 3e-13 gb|AHI44281.1| farnesyl pyrophosphate synthase [Gossypium hirsutum] 80 4e-13 gb|AHC30884.1| farnesyl pyrophosphate synthetase 1 [Dendrobium h... 79 5e-13 ref|XP_006398480.1| hypothetical protein EUTSA_v10000912mg [Eutr... 79 5e-13 ref|XP_004486372.1| PREDICTED: farnesyl pyrophosphate synthase 1... 79 5e-13 ref|XP_007211529.1| hypothetical protein PRUPE_ppa008181mg [Prun... 79 5e-13 gb|AAK63847.1|AF384040_1 farnesyl diphosphate synthase [Mentha x... 79 5e-13 >sp|P49352.1|FPPS2_LUPAL RecName: Full=Farnesyl pyrophosphate synthase 2; Short=FPP synthase 2; Short=FPS 2; AltName: Full=(2E,6E)-farnesyl diphosphate synthase 2; AltName: Full=Dimethylallyltranstransferase 2; AltName: Full=Farnesyl diphosphate synthase 2; AltName: Full=Geranyltranstransferase 2 gi|710350|gb|AAA87729.1| farnesyl pyrophosphate synthase [Lupinus albus] Length = 342 Score = 83.2 bits (204), Expect = 4e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 +DPKS FLNVYS+LKSELL DPAFEF+ DSRQW+ERMLDYNVPG Sbjct: 2 ADPKSSFLNVYSILKSELLQDPAFEFSTDSRQWVERMLDYNVPG 45 >gb|EYU33721.1| hypothetical protein MIMGU_mgv1a008270mg [Mimulus guttatus] Length = 379 Score = 82.0 bits (201), Expect = 8e-14 Identities = 42/65 (64%), Positives = 46/65 (70%) Frame = -2 Query: 197 RTQTSHISPTFSLMASPNESTSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLD 18 R T H + P + +D KS FL VYSVLKSELL+DP FEFTDDSRQWIERMLD Sbjct: 18 RFLTQHTVTHSPPLLRPLSTMADLKSKFLQVYSVLKSELLNDPNFEFTDDSRQWIERMLD 77 Query: 17 YNVPG 3 YNVPG Sbjct: 78 YNVPG 82 >ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifera] gi|62199628|gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera] Length = 341 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 S+ KS FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >emb|CBI39786.3| unnamed protein product [Vitis vinifera] Length = 341 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 S+ KS FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SETKSKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AGS79228.1| farnesyl diphosphate synthase [Panax notoginseng] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AAY87903.1| farnesyl diphosphate synthase [Panax ginseng] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AFO67222.1| putative farnesyl diphosphate synthase, partial [Aralia elata] Length = 245 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|ADJ68004.1| farnesyl diphosphate synthase [Panax quinquefolius] gi|484847891|gb|AGK62445.1| farnesyl diphosphate synthase [Panax quinquefolius] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|ADK12004.1| farnesyl diphosphate synthase [Aralia elata] Length = 342 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AAY53905.1| farnesyl pyrophosphate synthase [Panax notoginseng] Length = 343 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AEG47693.1| farnesyl diphosphate synthase [Allium sativum] Length = 341 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 S+ K+ FL VYSVLKSELL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SETKAKFLEVYSVLKSELLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] Length = 342 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 SD K+ FL VYSVLKS+LL+DPAFEFTDDSRQW+ERMLDYNVPG Sbjct: 2 SDLKTRFLEVYSVLKSDLLNDPAFEFTDDSRQWVERMLDYNVPG 45 >gb|ADV03080.1| farnesyl diphosphate synthase [Bacopa monnieri] Length = 349 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 158 MASPNESTSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 MA+ N T+D + FL VYSVLKSELL+DPAFE+TD SR+W+ERMLDYNVPG Sbjct: 1 MANHNGQTTDLREAFLGVYSVLKSELLNDPAFEWTDASREWVERMLDYNVPG 52 >gb|ABV08819.1| farnesyl diphosphate synthetase [Salvia miltiorrhiza] gi|315019238|gb|ADT70780.1| farnesyl pyrophosphate synthase [Salvia miltiorrhiza] Length = 349 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 158 MASPNESTSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 MA+ N ++D ++ FL VYSVLKSELL+DPAFE+TD SRQW+ERMLDYNVPG Sbjct: 1 MANLNGESADLRATFLGVYSVLKSELLNDPAFEWTDGSRQWVERMLDYNVPG 52 >gb|AHI44281.1| farnesyl pyrophosphate synthase [Gossypium hirsutum] Length = 342 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 +D +S FLNVYS LKSELL DP+FEFTDDSRQW+ERMLDYNVPG Sbjct: 2 ADLRSAFLNVYSQLKSELLQDPSFEFTDDSRQWVERMLDYNVPG 45 >gb|AHC30884.1| farnesyl pyrophosphate synthetase 1 [Dendrobium huoshanense] gi|566034916|gb|AHC30885.1| farnesyl pyrophosphate synthetase 2 [Dendrobium huoshanense] Length = 348 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -2 Query: 158 MASPNESTSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 MA N T D K+ FL +YS LKS+LLDDPAF FT+DSRQWI+RMLDYNVPG Sbjct: 1 MAEANGKTVDLKTNFLQIYSRLKSDLLDDPAFSFTEDSRQWIDRMLDYNVPG 52 >ref|XP_006398480.1| hypothetical protein EUTSA_v10000912mg [Eutrema salsugineum] gi|557099569|gb|ESQ39933.1| hypothetical protein EUTSA_v10000912mg [Eutrema salsugineum] Length = 394 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/70 (55%), Positives = 52/70 (74%), Gaps = 4/70 (5%) Frame = -2 Query: 200 KRTQTSHISPTFSLMASPNE----STSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWI 33 + Q++ +S + S +S + S +D KS FLNVYS+LKS+LL DP+FEFTD+SR W+ Sbjct: 28 RHIQSTQLSSSSSSSSSSHHHHLSSMADLKSTFLNVYSILKSDLLHDPSFEFTDESRLWV 87 Query: 32 ERMLDYNVPG 3 ERMLDYNVPG Sbjct: 88 ERMLDYNVPG 97 >ref|XP_004486372.1| PREDICTED: farnesyl pyrophosphate synthase 1-like [Cicer arietinum] Length = 342 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 +D KS FLNVYSVLKSELL DPAFE++DDSRQW++RMLDYNVPG Sbjct: 2 ADLKSTFLNVYSVLKSELLHDPAFEWSDDSRQWVDRMLDYNVPG 45 >ref|XP_007211529.1| hypothetical protein PRUPE_ppa008181mg [Prunus persica] gi|462407394|gb|EMJ12728.1| hypothetical protein PRUPE_ppa008181mg [Prunus persica] Length = 342 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 134 SDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 +D KS FL VYSVLKSELL+DPAFEFT+DSRQW+ERM+DYNVPG Sbjct: 2 ADLKSKFLQVYSVLKSELLEDPAFEFTNDSRQWVERMMDYNVPG 45 >gb|AAK63847.1|AF384040_1 farnesyl diphosphate synthase [Mentha x piperita] Length = 349 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 158 MASPNESTSDPKSIFLNVYSVLKSELLDDPAFEFTDDSRQWIERMLDYNVPG 3 MA+ N + SD + FL VYS LKSELL+DPAFE+TD SRQW+ERMLDYNVPG Sbjct: 1 MANLNGAASDLRKTFLGVYSTLKSELLNDPAFEWTDGSRQWVERMLDYNVPG 52