BLASTX nr result
ID: Akebia25_contig00029321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00029321 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018807.1| Mitochondrial transcription termination fact... 102 5e-20 ref|XP_007203712.1| hypothetical protein PRUPE_ppa019287mg [Prun... 101 9e-20 emb|CBI19144.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_007227670.1| hypothetical protein PRUPE_ppa026773mg, part... 97 2e-18 ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 97 2e-18 ref|XP_004301319.1| PREDICTED: uncharacterized protein LOC101291... 93 3e-17 ref|XP_006836453.1| hypothetical protein AMTR_s00871p00002780 [A... 83 3e-14 ref|XP_006434012.1| hypothetical protein CICLE_v10001449mg [Citr... 82 8e-14 ref|XP_006826940.1| hypothetical protein AMTR_s00010p00181420 [A... 82 8e-14 ref|XP_006472626.1| PREDICTED: uncharacterized protein LOC102613... 80 2e-13 ref|XP_004237871.1| PREDICTED: uncharacterized protein LOC101267... 79 5e-13 ref|XP_006354084.1| PREDICTED: uncharacterized protein LOC102602... 79 8e-13 gb|EYU36514.1| hypothetical protein MIMGU_mgv11b017281mg [Mimulu... 78 1e-12 gb|EYU36513.1| hypothetical protein MIMGU_mgv11b018711mg [Mimulu... 77 3e-12 ref|XP_006842722.1| hypothetical protein AMTR_s01360p00009540 [A... 76 4e-12 gb|EPS60354.1| hypothetical protein M569_14450 [Genlisea aurea] 76 4e-12 gb|EYU36515.1| hypothetical protein MIMGU_mgv1a024717mg, partial... 75 9e-12 gb|EYU23813.1| hypothetical protein MIMGU_mgv11b0151381mg, parti... 75 9e-12 ref|XP_006827035.1| hypothetical protein AMTR_s00010p00225110 [A... 74 2e-11 gb|EYU23214.1| hypothetical protein MIMGU_mgv1a008364mg [Mimulus... 74 2e-11 >ref|XP_007018807.1| Mitochondrial transcription termination factor family protein, putative [Theobroma cacao] gi|508724135|gb|EOY16032.1| Mitochondrial transcription termination factor family protein, putative [Theobroma cacao] Length = 380 Score = 102 bits (254), Expect = 5e-20 Identities = 48/83 (57%), Positives = 62/83 (74%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T ENWELKL LFR LG SED+I FRR+P FAVSE+KI+E+T+ LL K D++++ Sbjct: 253 TEENWELKLKLFRRLGFSEDDIRSAFRRVPQAFAVSERKIKEVTELLLSRKNIDISFIIN 312 Query: 72 HPELLIYSLEGRIKPRTQILEIL 4 HPE+LI S+E R+KPR + EIL Sbjct: 313 HPEVLICSVERRLKPRLLVFEIL 335 >ref|XP_007203712.1| hypothetical protein PRUPE_ppa019287mg [Prunus persica] gi|462399243|gb|EMJ04911.1| hypothetical protein PRUPE_ppa019287mg [Prunus persica] Length = 367 Score = 101 bits (252), Expect = 9e-20 Identities = 48/84 (57%), Positives = 64/84 (76%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T E WELK+ LF+SLG SE++I +FRR P VFA SEKKI+E + LL + K D+++L + Sbjct: 248 TLETWELKVKLFQSLGFSENDILVVFRRAPQVFATSEKKIKEAIEMLLSSGKVDISFLVI 307 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 HPELLI S+E R+KPR Q++E LE Sbjct: 308 HPELLICSVEHRLKPRLQVIENLE 331 >emb|CBI19144.3| unnamed protein product [Vitis vinifera] Length = 425 Score = 98.2 bits (243), Expect = 1e-18 Identities = 50/84 (59%), Positives = 62/84 (73%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T ENWELKL LFRSLG SE+EI FR+ P VFA+SE+KI E T FLL D++YL Sbjct: 255 TLENWELKLKLFRSLGFSENEIVTSFRKAPQVFALSERKIIEGTRFLLTVGNSDMSYLVN 314 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 H ELLI+S+E R+KPR ++LE L+ Sbjct: 315 HAELLIFSIEKRLKPRFRVLEFLQ 338 >ref|XP_007227670.1| hypothetical protein PRUPE_ppa026773mg, partial [Prunus persica] gi|462424606|gb|EMJ28869.1| hypothetical protein PRUPE_ppa026773mg, partial [Prunus persica] Length = 381 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/82 (54%), Positives = 60/82 (73%) Frame = -2 Query: 246 ENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALHP 67 E WE+K+ LF+SLG SE + FRR P VF +SEKKI+E T+ LL + K D+A++ HP Sbjct: 265 ETWEMKVKLFQSLGFSEKGVLVAFRRAPQVFCISEKKIKEATEMLLSSGKADIAFIVSHP 324 Query: 66 ELLIYSLEGRIKPRTQILEILE 1 ELLI S+E R+KPR Q++E LE Sbjct: 325 ELLICSVEHRLKPRLQVMENLE 346 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/84 (51%), Positives = 61/84 (72%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T ENWELKL L R LGLSE+ I +F+R+P FA+SE+KI+++T LL D++Y+ Sbjct: 253 TVENWELKLKLLRDLGLSEENILSVFKRVPQAFAISERKIKDVTKLLLNVGNLDISYIVR 312 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 HP+LLI S+ R+KPR +L++LE Sbjct: 313 HPDLLICSVNQRLKPRLAVLQVLE 336 >ref|XP_004301319.1| PREDICTED: uncharacterized protein LOC101291731 [Fragaria vesca subsp. vesca] Length = 363 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/82 (54%), Positives = 61/82 (74%) Frame = -2 Query: 246 ENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALHP 67 E ELK LFRSLG SE ++F MF+R P VF +SEKK++E+T+ L+ + V YL +P Sbjct: 241 ETLELKKKLFRSLGFSEKDVFTMFKRSPMVFGISEKKLKEVTELLVSAGQFHVPYLLSNP 300 Query: 66 ELLIYSLEGRIKPRTQILEILE 1 ELL+YS+E R+KPR ++LEILE Sbjct: 301 ELLMYSVERRLKPRLKVLEILE 322 >ref|XP_006836453.1| hypothetical protein AMTR_s00871p00002780 [Amborella trichopoda] gi|548838974|gb|ERM99306.1| hypothetical protein AMTR_s00871p00002780 [Amborella trichopoda] Length = 378 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/83 (48%), Positives = 56/83 (67%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T+E WE K+ LF+S G SE ++ F+R P+V VSE+KIR +F L T K D Y+ L Sbjct: 251 TKEKWEEKIKLFQSFGWSEKDVITAFKRAPHVLLVSEEKIRCAMEFYLNTLKFDGPYMIL 310 Query: 72 HPELLIYSLEGRIKPRTQILEIL 4 HP LL++S EGR+ PR +++E L Sbjct: 311 HPTLLMFSFEGRVVPRHRVVEHL 333 >ref|XP_006434012.1| hypothetical protein CICLE_v10001449mg [Citrus clementina] gi|557536134|gb|ESR47252.1| hypothetical protein CICLE_v10001449mg [Citrus clementina] Length = 389 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/84 (45%), Positives = 56/84 (66%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T+E WELKL LFRSLG SED I MFR +P F VSE+KIR + + LL + D++ + Sbjct: 260 TKEKWELKLKLFRSLGFSEDNILSMFRSMPPAFTVSERKIRSVVETLLRRRDVDISSIVN 319 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 + L + S+E +KPR ++ ++L+ Sbjct: 320 NASLFLCSIESNLKPRMRVYDMLK 343 >ref|XP_006826940.1| hypothetical protein AMTR_s00010p00181420 [Amborella trichopoda] gi|548831369|gb|ERM94177.1| hypothetical protein AMTR_s00010p00181420 [Amborella trichopoda] Length = 378 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/84 (45%), Positives = 58/84 (69%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T+E WE K+ LF+S G +E ++ F++ P+V VSE+KIR +F L T K D Y+ L Sbjct: 251 TKEKWEEKIKLFQSFGWTEKDVITAFKKAPHVLLVSEEKIRCAMEFYLNTLKFDGPYMIL 310 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 HP+LL++S EGR+ PR +++E L+ Sbjct: 311 HPKLLMFSFEGRVVPRHRVVEHLK 334 >ref|XP_006472626.1| PREDICTED: uncharacterized protein LOC102613149 [Citrus sinensis] Length = 388 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/84 (44%), Positives = 56/84 (66%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T+E WELKL LFRSLG SED I MFR +P F VSE+KI+ + + LL + D++ + Sbjct: 259 TKEKWELKLKLFRSLGFSEDNILSMFRSMPPAFTVSERKIQSVVETLLRRRDVDISSIVN 318 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 + L + S+E +KPR ++ ++L+ Sbjct: 319 NASLFLCSIESNLKPRMRVYDMLK 342 >ref|XP_004237871.1| PREDICTED: uncharacterized protein LOC101267518 [Solanum lycopersicum] Length = 379 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/83 (42%), Positives = 55/83 (66%) Frame = -2 Query: 249 RENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALH 70 + +E K+ +F+S G S D + MFR++P A+SE KI++ F + C+ AYLA H Sbjct: 250 KSKYENKIEIFKSFGWSNDYVLMMFRKLPYCIALSEDKIQKALSFYMNRLGCEPAYLASH 309 Query: 69 PELLIYSLEGRIKPRTQILEILE 1 P +L++SLE R+ PR Q+L+IL+ Sbjct: 310 PSILVFSLEKRVVPRMQVLKILD 332 >ref|XP_006354084.1| PREDICTED: uncharacterized protein LOC102602405 [Solanum tuberosum] Length = 877 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/83 (42%), Positives = 55/83 (66%) Frame = -2 Query: 249 RENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALH 70 + +E K+ +F+S G S D + MFR++P A+SE KI++ F + C+ AYLA H Sbjct: 748 QSKYENKIEIFKSFGWSNDYVLMMFRKLPYCIALSEDKIQKALSFYMKRLGCEPAYLASH 807 Query: 69 PELLIYSLEGRIKPRTQILEILE 1 P +L++SLE R+ PR Q+L+IL+ Sbjct: 808 PSILVFSLEKRVVPRVQVLKILD 830 >gb|EYU36514.1| hypothetical protein MIMGU_mgv11b017281mg [Mimulus guttatus] Length = 453 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/84 (47%), Positives = 54/84 (64%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 + E ELKL F +LG SED+I FR +P VF VSEKKI+E+ D L T K ++ + Sbjct: 247 SEETLELKLRTFHALGFSEDDIAATFRSVPLVFGVSEKKIKEVKDVLFATGKYKMSCIVK 306 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 +P +YS+E R PR ++LEILE Sbjct: 307 NPVSFMYSVEKRYMPRFKVLEILE 330 >gb|EYU36513.1| hypothetical protein MIMGU_mgv11b018711mg [Mimulus guttatus] Length = 283 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/84 (41%), Positives = 57/84 (67%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 T E WE KL F++LG S+++I FR+ P VF++SE+K++++ + L+ + K D + + Sbjct: 150 TDETWEQKLKAFKNLGFSDEDIVETFRKAPQVFSMSEEKMKKLKEILIASGKYDFSCVIS 209 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 HP LI S+E + KPR Q+L +LE Sbjct: 210 HPTSLICSVENKYKPRLQVLGVLE 233 >ref|XP_006842722.1| hypothetical protein AMTR_s01360p00009540 [Amborella trichopoda] gi|548844824|gb|ERN04397.1| hypothetical protein AMTR_s01360p00009540 [Amborella trichopoda] Length = 330 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/83 (42%), Positives = 54/83 (65%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 +RE W+ K+ L ++ G SE+++ FRR P +F++SEKK++ D+ + K D YL L Sbjct: 200 SRETWQAKVELCKNFGWSEEDVICAFRRSPYLFSLSEKKLKMGMDYFINVLKLDKFYLVL 259 Query: 72 HPELLIYSLEGRIKPRTQILEIL 4 HP L SLEGR+ PR ++L+ L Sbjct: 260 HPVLFSLSLEGRVIPRHRVLQAL 282 >gb|EPS60354.1| hypothetical protein M569_14450 [Genlisea aurea] Length = 326 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/80 (45%), Positives = 52/80 (65%) Frame = -2 Query: 240 WELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALHPEL 61 WE K+ FR LG +E EI +F+R P FA S +K++ +T+ LL T+K A + + Sbjct: 208 WEKKMQAFRDLGFTEAEILIIFKRAPRAFAASTQKLKMVTEMLLATEKYSKAGIVSYAVA 267 Query: 60 LIYSLEGRIKPRTQILEILE 1 L YS+E R+KPR +IL+ILE Sbjct: 268 LCYSVENRLKPRLEILKILE 287 >gb|EYU36515.1| hypothetical protein MIMGU_mgv1a024717mg, partial [Mimulus guttatus] Length = 274 Score = 75.1 bits (183), Expect = 9e-12 Identities = 39/82 (47%), Positives = 54/82 (65%) Frame = -2 Query: 246 ENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALHP 67 + WE KL FR LG SE+ I +FR P +F +SE+KIR++ FLL T K D++ + +P Sbjct: 159 DTWEHKLKAFRDLGFSEEGIVRLFRVEPLLFCISEEKIRKLERFLLATGKYDLSCIVKNP 218 Query: 66 ELLIYSLEGRIKPRTQILEILE 1 L S+E R +PR Q+LEILE Sbjct: 219 TSLTRSIEKRYEPRFQVLEILE 240 >gb|EYU23813.1| hypothetical protein MIMGU_mgv11b0151381mg, partial [Mimulus guttatus] Length = 272 Score = 75.1 bits (183), Expect = 9e-12 Identities = 39/82 (47%), Positives = 54/82 (65%) Frame = -2 Query: 246 ENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLALHP 67 + WE KL FR LG SE+ I +FR P +F +SE+KIR++ FLL T K D++ + +P Sbjct: 134 DTWEHKLKAFRDLGFSEEGIVRLFRVEPLLFCISEEKIRKLERFLLATGKYDLSCIVKNP 193 Query: 66 ELLIYSLEGRIKPRTQILEILE 1 L S+E R +PR Q+LEILE Sbjct: 194 TSLTRSIEKRYEPRFQVLEILE 215 >ref|XP_006827035.1| hypothetical protein AMTR_s00010p00225110 [Amborella trichopoda] gi|548831464|gb|ERM94272.1| hypothetical protein AMTR_s00010p00225110 [Amborella trichopoda] Length = 330 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/83 (40%), Positives = 53/83 (63%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 +RE W+ K+ L ++ G SE+++ FRR P +F +SEKK++ D+ + K D YL Sbjct: 200 SRETWQGKVELCKNFGWSEEDVMCAFRRFPYLFTLSEKKLKMGMDYFINVLKLDKFYLVS 259 Query: 72 HPELLIYSLEGRIKPRTQILEIL 4 HP L +SLEGR+ PR ++L+ L Sbjct: 260 HPVLFSHSLEGRVIPRHRVLQAL 282 >gb|EYU23214.1| hypothetical protein MIMGU_mgv1a008364mg [Mimulus guttatus] Length = 376 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/84 (45%), Positives = 55/84 (65%) Frame = -2 Query: 252 TRENWELKLHLFRSLGLSEDEIFFMFRRIPNVFAVSEKKIREITDFLLGTKKCDVAYLAL 73 + E WELKL FR LG SE+EI MF + P+ F+VS KI+++ + LLGT K + + Sbjct: 252 SNEAWELKLQGFRDLGFSENEILAMFVKAPSAFSVSMVKIKKVKEVLLGTGKFSKSSIVN 311 Query: 72 HPELLIYSLEGRIKPRTQILEILE 1 +P S+E R++PR +ILEI+E Sbjct: 312 NPMSFACSIEKRLEPRIRILEIME 335