BLASTX nr result
ID: Akebia25_contig00029071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00029071 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28995.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002267399.1| PREDICTED: superoxide dismutase [Fe], chloro... 72 8e-11 ref|XP_006605648.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 64 3e-08 ref|XP_003555663.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 63 4e-08 ref|XP_004506460.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 59 9e-07 ref|XP_004506461.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 58 1e-06 ref|XP_007146078.1| hypothetical protein PHAVU_006G010800g [Phas... 57 2e-06 ref|XP_004501984.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 57 3e-06 ref|XP_004501982.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 57 3e-06 ref|XP_004501983.1| PREDICTED: superoxide dismutase [Fe] 3, chlo... 57 3e-06 >emb|CBI28995.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/68 (52%), Positives = 50/68 (73%), Gaps = 2/68 (2%) Frame = +1 Query: 85 RAEMGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSL--KGLFRGPQRSLTTRAFYGLTSP 258 + EMG+CCNN ++P ++H+L T+ S+ +K PKL +L KG F G Q++ AFYGL +P Sbjct: 55 KEEMGYCCNN-SFPASSHVLLTDLSQRWKCPKLQNLRHKGQFHGSQKASKVLAFYGLKAP 113 Query: 259 PYKLDALE 282 PYKLDALE Sbjct: 114 PYKLDALE 121 >ref|XP_002267399.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera] Length = 264 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/65 (53%), Positives = 48/65 (73%), Gaps = 2/65 (3%) Frame = +1 Query: 94 MGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSL--KGLFRGPQRSLTTRAFYGLTSPPYK 267 MG+CCNN ++P ++H+L T+ S+ +K PKL +L KG F G Q++ AFYGL +PPYK Sbjct: 1 MGYCCNN-SFPASSHVLLTDLSQRWKCPKLQNLRHKGQFHGSQKASKVLAFYGLKAPPYK 59 Query: 268 LDALE 282 LDALE Sbjct: 60 LDALE 64 >ref|XP_006605648.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X2 [Glycine max] Length = 305 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/66 (51%), Positives = 41/66 (62%) Frame = +1 Query: 85 RAEMGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPY 264 + M C NP P ++HL+ + SR FKIPKL K F G RS AFYGLT+PPY Sbjct: 41 KVAMASCYFNPI-PTSSHLILADLSRQFKIPKLLHRKKRFDGSPRSSKIAAFYGLTTPPY 99 Query: 265 KLDALE 282 +LDALE Sbjct: 100 ELDALE 105 >ref|XP_003555663.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X1 [Glycine max] Length = 262 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/63 (53%), Positives = 40/63 (63%) Frame = +1 Query: 94 MGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPYKLD 273 M C NP P ++HL+ + SR FKIPKL K F G RS AFYGLT+PPY+LD Sbjct: 1 MASCYFNPI-PTSSHLILADLSRQFKIPKLLHRKKRFDGSPRSSKIAAFYGLTTPPYELD 59 Query: 274 ALE 282 ALE Sbjct: 60 ALE 62 >ref|XP_004506460.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X1 [Cicer arietinum] Length = 269 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = +1 Query: 85 RAEMGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPY 264 + M FC NP P ++HL++ + SR FKIPKL K RS AFYGL +PPY Sbjct: 5 KVAMAFCYFNPI-PTSSHLISPDLSRNFKIPKLLHRKKRLGVLSRSSKVTAFYGLKTPPY 63 Query: 265 KLDALE 282 +LDALE Sbjct: 64 ELDALE 69 >ref|XP_004506461.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X2 [Cicer arietinum] Length = 262 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/63 (50%), Positives = 39/63 (61%) Frame = +1 Query: 94 MGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPYKLD 273 M FC NP P ++HL++ + SR FKIPKL K RS AFYGL +PPY+LD Sbjct: 1 MAFCYFNPI-PTSSHLISPDLSRNFKIPKLLHRKKRLGVLSRSSKVTAFYGLKTPPYELD 59 Query: 274 ALE 282 ALE Sbjct: 60 ALE 62 >ref|XP_007146078.1| hypothetical protein PHAVU_006G010800g [Phaseolus vulgaris] gi|561019301|gb|ESW18072.1| hypothetical protein PHAVU_006G010800g [Phaseolus vulgaris] Length = 262 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +1 Query: 130 NTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPYKLDALE 282 ++HL++ N SR FKIPKL K F G RS +FYGL +PPY+LDALE Sbjct: 12 SSHLVSANLSRKFKIPKLLHRKKRFDGSPRSSKITSFYGLKTPPYELDALE 62 >ref|XP_004501984.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X3 [Cicer arietinum] Length = 273 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/66 (46%), Positives = 41/66 (62%) Frame = +1 Query: 85 RAEMGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPY 264 + M FC N + P ++HL++ + S+ FKIPKL K F RS AFYGL +PPY Sbjct: 9 KVAMAFCYFN-SIPTSSHLISPDLSQKFKIPKLLHRKKRFGVLPRSSKVTAFYGLKAPPY 67 Query: 265 KLDALE 282 +LDALE Sbjct: 68 ELDALE 73 >ref|XP_004501982.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X1 [Cicer arietinum] Length = 302 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/66 (46%), Positives = 41/66 (62%) Frame = +1 Query: 85 RAEMGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPY 264 + M FC N + P ++HL++ + S+ FKIPKL K F RS AFYGL +PPY Sbjct: 9 KVAMAFCYFN-SIPTSSHLISPDLSQKFKIPKLLHRKKRFGVLPRSSKVTAFYGLKAPPY 67 Query: 265 KLDALE 282 +LDALE Sbjct: 68 ELDALE 73 >ref|XP_004501983.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like isoform X2 [Cicer arietinum] Length = 291 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = +1 Query: 94 MGFCCNNPTYPHNTHLLATNFSRPFKIPKLPSLKGLFRGPQRSLTTRAFYGLTSPPYKLD 273 M FC N + P ++HL++ + S+ FKIPKL K F RS AFYGL +PPY+LD Sbjct: 1 MAFCYFN-SIPTSSHLISPDLSQKFKIPKLLHRKKRFGVLPRSSKVTAFYGLKAPPYELD 59 Query: 274 ALE 282 ALE Sbjct: 60 ALE 62