BLASTX nr result
ID: Akebia25_contig00028808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00028808 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75646.1| hypothetical protein VITISV_031269 [Vitis vinifera] 76 2e-15 emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] 77 1e-14 emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] 76 1e-14 emb|CAN82037.1| hypothetical protein VITISV_033902 [Vitis vinifera] 74 7e-14 emb|CAN61532.1| hypothetical protein VITISV_017628 [Vitis vinifera] 72 1e-13 emb|CAN64680.1| hypothetical protein VITISV_016601 [Vitis vinifera] 70 6e-13 emb|CCA66178.1| hypothetical protein [Beta vulgaris subsp. vulga... 63 1e-12 emb|CAN70399.1| hypothetical protein VITISV_023214 [Vitis vinifera] 69 1e-12 emb|CAN70803.1| hypothetical protein VITISV_044067 [Vitis vinifera] 72 2e-12 emb|CAN78577.1| hypothetical protein VITISV_020585 [Vitis vinifera] 72 2e-12 emb|CAN68112.1| hypothetical protein VITISV_040983 [Vitis vinifera] 70 2e-12 emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] 71 3e-12 ref|XP_002272748.2| PREDICTED: uncharacterized protein LOC100256... 71 3e-12 emb|CAN71630.1| hypothetical protein VITISV_015580 [Vitis vinifera] 69 3e-12 emb|CAN76026.1| hypothetical protein VITISV_027817 [Vitis vinifera] 71 3e-12 emb|CAN79574.1| hypothetical protein VITISV_017342 [Vitis vinifera] 66 3e-12 emb|CAN64222.1| hypothetical protein VITISV_037395 [Vitis vinifera] 74 3e-12 emb|CAN80388.1| hypothetical protein VITISV_000106 [Vitis vinifera] 68 4e-12 emb|CAN60595.1| hypothetical protein VITISV_015221 [Vitis vinifera] 68 4e-12 emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera] 68 5e-12 >emb|CAN75646.1| hypothetical protein VITISV_031269 [Vitis vinifera] Length = 1701 Score = 76.3 bits (186), Expect(2) = 2e-15 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL +++ +GFG+KW G I ++ FS+L+NG P GYF SRGLRQGDPLS +LFVI Sbjct: 1079 NFLLFVLQNMGFGEKWIGWISWCISIATFSVLINGTPEGYFNSSRGLRQGDPLSPYLFVI 1138 Score = 31.2 bits (69), Expect(2) = 2e-15 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRVIE---NGPLVPHLQFDNDTLVF 49 +A+ LSG RV NG LV HL FD+DTLVF Sbjct: 1149 RAVGGGFLSGCRVDGRGGNGALVSHLLFDDDTLVF 1183 >emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] Length = 1971 Score = 77.0 bits (188), Expect(2) = 1e-14 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL +++ +GFG+KW G I +++ FS+L+NG P GYF SRGLRQGDPLS +LFV+ Sbjct: 897 NFLLFVLQSMGFGEKWIGWISWCISTATFSVLINGTPEGYFNSSRGLRQGDPLSPYLFVL 956 Score = 28.1 bits (61), Expect(2) = 1e-14 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRVIE---NGPLVPHLQFDNDTLVF 49 +A+ LSG RV NG LV HL F +DTLVF Sbjct: 967 RAVGGGFLSGCRVNGRGGNGALVSHLLFADDTLVF 1001 >emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] Length = 3028 Score = 75.9 bits (185), Expect(2) = 1e-14 Identities = 33/60 (55%), Positives = 45/60 (75%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 +FL +++ +GFG+KW G I +++ FS+L+NG P GYF SRGLRQGDPLS +LFVI Sbjct: 2451 DFLIFVLQSMGFGEKWIGWISWCISTATFSVLINGTPEGYFNSSRGLRQGDPLSPYLFVI 2510 Score = 28.9 bits (63), Expect(2) = 1e-14 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 144 KAINIWSLSGFRVIE---NGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 +A+ LSG RV NG LV HL F +DTLVF S D++ YL Sbjct: 2521 RAVGGGFLSGCRVDGRGGNGVLVSHLLFADDTLVF---CEASEDQMVYL 2566 >emb|CAN82037.1| hypothetical protein VITISV_033902 [Vitis vinifera] Length = 1109 Score = 74.3 bits (181), Expect(2) = 7e-14 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL ++ +GFG+KW G I +++ FS+L+NG P G+F SRGLRQGDP+S +LFVI Sbjct: 487 NFLMVVLQSMGFGEKWIGWISWCISTATFSVLINGTPEGFFNSSRGLRQGDPISPYLFVI 546 Score = 28.1 bits (61), Expect(2) = 7e-14 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRVIE---NGPLVPHLQFDNDTLVF 49 +A+ LSG RV NG LV HL F +DTLVF Sbjct: 557 RAVEGGFLSGCRVDGRGGNGALVSHLLFADDTLVF 591 >emb|CAN61532.1| hypothetical protein VITISV_017628 [Vitis vinifera] Length = 696 Score = 71.6 bits (174), Expect(2) = 1e-13 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -2 Query: 308 LGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 +GFG+KW I + +++ FS+LVNG P G+F+ SRGLRQGDPLS +LFVIV Sbjct: 185 MGFGEKWIRWIKRCISTASFSVLVNGTPTGFFQSSRGLRQGDPLSPYLFVIV 236 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 144 KAINIWSLSGFRV---IENGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 +A+ LSG RV E G L+ HL F +DTLVF S+D++ YL Sbjct: 246 RAVEGGFLSGCRVKGRSEEGVLISHLLFADDTLVF---CKPSQDQLTYL 291 >emb|CAN64680.1| hypothetical protein VITISV_016601 [Vitis vinifera] Length = 971 Score = 70.5 bits (171), Expect(2) = 6e-13 Identities = 30/60 (50%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NF+ ++ +GFG+KW I +++ FS+++NG P G+F+ SRGLRQGDPLS +LFVI Sbjct: 347 NFILTIMKKMGFGEKWIRWIQWCISTASFSVMINGTPTGFFQSSRGLRQGDPLSPYLFVI 406 Score = 28.9 bits (63), Expect(2) = 6e-13 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -1 Query: 123 LSGFRV---IENGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 LSG RV E G ++ HL F +DTLVF S+D++ YL Sbjct: 424 LSGCRVKGRSEEGVIISHLLFADDTLVF---CKPSQDQLTYL 462 >emb|CCA66178.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1381 Score = 62.8 bits (151), Expect(2) = 1e-12 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 +FL+++++ + F ++W IM VT+ SILVNG P+ F+ RGLRQGDPLS FLFV+ Sbjct: 584 SFLKWILMQMRFPEQWCQWIMTCVTTASASILVNGSPSTPFKLKRGLRQGDPLSPFLFVL 643 Query: 155 V 153 + Sbjct: 644 I 644 Score = 35.8 bits (81), Expect(2) = 1e-12 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = -1 Query: 144 KAINIWSLSGFRVIENGPLVPHLQFDNDTLVFF*RMVESRDKVK 13 KA N+ SG V NG + HLQ+ +DTLVF +ES +K Sbjct: 654 KATNMGLWSGVEVCRNGLKITHLQYADDTLVFSDARLESLKNIK 697 >emb|CAN70399.1| hypothetical protein VITISV_023214 [Vitis vinifera] Length = 844 Score = 68.9 bits (167), Expect(2) = 1e-12 Identities = 31/60 (51%), Positives = 43/60 (71%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NF+ ++ +G G+KW I +++ FS+LVNG P G+F+ SRGLRQGDPLS +LFVI Sbjct: 462 NFILTVMQKMGLGEKWIRWIKWCISTASFSVLVNGTPTGFFQSSRGLRQGDPLSPYLFVI 521 Score = 29.6 bits (65), Expect(2) = 1e-12 Identities = 20/42 (47%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -1 Query: 123 LSGFRV---IENGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 LSG RV E G L+ HL F +DTLVF S+D++ YL Sbjct: 539 LSGCRVKGRSEEGVLISHLLFADDTLVF---CKPSQDQLTYL 577 >emb|CAN70803.1| hypothetical protein VITISV_044067 [Vitis vinifera] Length = 1850 Score = 71.6 bits (174), Expect(2) = 2e-12 Identities = 31/60 (51%), Positives = 45/60 (75%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 +F+ ++ +GFG+KW G I +++ FS+L+NG P G+F+ SRGLRQGDPLS +LFVI Sbjct: 1254 SFILTVMKKMGFGEKWLGWIKWCISTASFSVLINGTPKGFFQSSRGLRQGDPLSPYLFVI 1313 Score = 26.2 bits (56), Expect(2) = 2e-12 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 144 KAINIWSLSGFRVI---ENGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 +A++ +SG +V E G + HL F +DTLVF S+D++ YL Sbjct: 1324 RAVDNGYISGCQVKGRNEGGTQISHLLFADDTLVF---CQASQDQLTYL 1369 >emb|CAN78577.1| hypothetical protein VITISV_020585 [Vitis vinifera] Length = 1848 Score = 72.4 bits (176), Expect(2) = 2e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 +FL ++ +GFG+KW G I +++ FS+L+NG P G+F+ SRGLRQGDPLS +LFVI Sbjct: 1224 SFLLTVMQKMGFGEKWLGWIKWCISTASFSVLINGTPKGFFQSSRGLRQGDPLSPYLFVI 1283 Score = 25.4 bits (54), Expect(2) = 2e-12 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 144 KAINIWSLSGFRVI---ENGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 +A++ +SG +V E G + HL F +DTLVF S+D++ YL Sbjct: 1294 RAVDNGYISGCQVKGRNEGGIQISHLLFADDTLVF---CQASQDQLTYL 1339 >emb|CAN68112.1| hypothetical protein VITISV_040983 [Vitis vinifera] Length = 939 Score = 70.1 bits (170), Expect(2) = 2e-12 Identities = 31/60 (51%), Positives = 43/60 (71%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL ++ +GFG++W G I +++ FS+L+NG P G+F SRGL QGDPLS +LFVI Sbjct: 317 NFLLSVLQRMGFGERWTGWISWCISTATFSVLINGTPEGFFNSSRGLXQGDPLSPYLFVI 376 Score = 27.7 bits (60), Expect(2) = 2e-12 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -1 Query: 144 KAINIWSLSGFRVIE---NGPLVPHLQFDNDTLVFF*RMVESRDKVKYL 7 +A+ LSG R+ +G LV HL F +DTLVF S+D++ YL Sbjct: 387 RAVRGGFLSGCRIKGRRGDGALVSHLLFADDTLVF---CDSSQDEMAYL 432 >emb|CAN82456.1| hypothetical protein VITISV_010028 [Vitis vinifera] Length = 4128 Score = 71.2 bits (173), Expect(2) = 3e-12 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL ++ +GFG +W I ++T FSIL+NG P+G+FR SRGLRQGDPLS +LF++ Sbjct: 2995 NFLMEVMSKMGFGHRWINWIKWCCSTTSFSILINGSPSGFFRSSRGLRQGDPLSPYLFLL 3054 Score = 25.8 bits (55), Expect(2) = 3e-12 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 123 LSGFRVIENGP---LVPHLQFDNDTLVF 49 +SGFRV G +V HL F +DTL+F Sbjct: 3072 ISGFRVGGRGSEGLVVSHLLFADDTLIF 3099 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 308 LGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 +GFG KW I +++T FSIL+NG P+ +FR +RGLRQGDPLS +LF++V Sbjct: 1310 MGFGQKWINWISWCISTTNFSILINGTPSDFFRSTRGLRQGDPLSPYLFLLV 1361 >ref|XP_002272748.2| PREDICTED: uncharacterized protein LOC100256388 [Vitis vinifera] Length = 2667 Score = 71.2 bits (173), Expect(2) = 3e-12 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL ++ +GFG +W I ++T FSIL+NG P+G+FR SRGLRQGDPLS +LF++ Sbjct: 594 NFLMEVMSKMGFGHRWINWIKWCCSTTSFSILINGSPSGFFRSSRGLRQGDPLSPYLFLL 653 Score = 25.8 bits (55), Expect(2) = 3e-12 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 123 LSGFRVIENGP---LVPHLQFDNDTLVF 49 +SGFRV G +V HL F +DTL+F Sbjct: 671 ISGFRVGGRGSEGLVVSHLLFADDTLIF 698 >emb|CAN71630.1| hypothetical protein VITISV_015580 [Vitis vinifera] Length = 1742 Score = 68.6 bits (166), Expect(2) = 3e-12 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 5/76 (6%) Frame = -2 Query: 332 FLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 F+ ++ +GFG+KW I +++ FS+LVNG P G+F+ S+GLRQGDPLS +LFVI Sbjct: 992 FILTVMQKMGFGEKWIRWIKWCISTASFSVLVNGTPTGFFQSSKGLRQGDPLSXYLFVIA 1051 Query: 152 -----TFVRQLTYGRY 120 F+++ G Y Sbjct: 1052 MEVFSAFLQRAVEGGY 1067 Score = 28.5 bits (62), Expect(2) = 3e-12 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRV---IENGPLVPHLQFDNDTLVF 49 +A+ LSG RV E G L+ HL F +DTLVF Sbjct: 1061 RAVEGGYLSGCRVKGRSEEGALISHLLFADDTLVF 1095 >emb|CAN76026.1| hypothetical protein VITISV_027817 [Vitis vinifera] Length = 1728 Score = 71.2 bits (173), Expect(2) = 3e-12 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 NFL ++ +GFG +W I ++T FSIL+NG P+G+FR SRGLRQGDPLS +LF++ Sbjct: 675 NFLMEVMSKMGFGHRWINWIKWCCSTTSFSILINGSPSGFFRSSRGLRQGDPLSPYLFLL 734 Score = 25.8 bits (55), Expect(2) = 3e-12 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -1 Query: 123 LSGFRVIENGP---LVPHLQFDNDTLVF 49 +SGFRV G +V HL F +DTL+F Sbjct: 752 ISGFRVGGRGSEGLVVSHLLFADDTLIF 779 >emb|CAN79574.1| hypothetical protein VITISV_017342 [Vitis vinifera] Length = 1367 Score = 65.9 bits (159), Expect(2) = 3e-12 Identities = 29/59 (49%), Positives = 43/59 (72%) Frame = -2 Query: 332 FLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 FL ++ +GFG++W I +++ + +LVNG P+G+F+ SRGLRQGDPLS +LFVI Sbjct: 757 FLLVVLKQMGFGERWIKWIEWCISTVRYFVLVNGSPSGFFQSSRGLRQGDPLSPYLFVI 815 Score = 31.2 bits (69), Expect(2) = 3e-12 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -1 Query: 165 VCNCDFCKAINIWSLSGFRVIENGP---LVPHLQFDNDTLVFF*RMVESRDKVKYL 7 V +C +AIN LSG+R G L+ HL F +DTLVF ES+ ++ YL Sbjct: 819 VFSCLMRRAINGGFLSGWRAXGRGGEGILISHLLFVDDTLVF---CEESQGQLTYL 871 >emb|CAN64222.1| hypothetical protein VITISV_037395 [Vitis vinifera] Length = 1179 Score = 73.6 bits (179), Expect(2) = 3e-12 Identities = 35/77 (45%), Positives = 53/77 (68%), Gaps = 5/77 (6%) Frame = -2 Query: 335 NFLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVI 156 +FL ++ +GFG+KW G I +++T FS++VNG P G+F+ SRGLRQGDPLS +LFVI Sbjct: 600 SFLLTVMQKMGFGEKWIGWIKWCISTTSFSMMVNGTPKGFFQSSRGLRQGDPLSPYLFVI 659 Query: 155 V-----TFVRQLTYGRY 120 +F+++ G + Sbjct: 660 AMKVFRSFIKRAVEGGF 676 Score = 23.5 bits (49), Expect(2) = 3e-12 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 102 ENGPLVPHLQFDNDTLVF 49 E G + HL F +DTLVF Sbjct: 687 EEGVQISHLLFADDTLVF 704 >emb|CAN80388.1| hypothetical protein VITISV_000106 [Vitis vinifera] Length = 1130 Score = 68.2 bits (165), Expect(2) = 4e-12 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 5/76 (6%) Frame = -2 Query: 332 FLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 F+ ++ +GFG+KW I +++ FS+LVNG P G+F+ S+GLRQGDPLS +LFVI Sbjct: 710 FILTVMQKMGFGEKWIRWIKWCISTASFSVLVNGTPTGFFQSSKGLRQGDPLSPYLFVIA 769 Query: 152 -----TFVRQLTYGRY 120 F+++ G Y Sbjct: 770 MEXFSAFLQRAVEGGY 785 Score = 28.5 bits (62), Expect(2) = 4e-12 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRV---IENGPLVPHLQFDNDTLVF 49 +A+ LSG RV E G L+ HL F +DTLVF Sbjct: 779 RAVEGGYLSGCRVKGRSEEGALISHLLFADDTLVF 813 >emb|CAN60595.1| hypothetical protein VITISV_015221 [Vitis vinifera] Length = 849 Score = 68.2 bits (165), Expect(2) = 4e-12 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 5/76 (6%) Frame = -2 Query: 332 FLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 F+ ++ +GFG+KW I +++ FS+LVNG P G+F+ S+GLRQGDPLS +LFVI Sbjct: 226 FILTVMQKMGFGEKWIRWIKWCISTASFSVLVNGTPTGFFQSSKGLRQGDPLSPYLFVIA 285 Query: 152 -----TFVRQLTYGRY 120 F+++ G Y Sbjct: 286 MEDFSAFLQRAVEGGY 301 Score = 28.5 bits (62), Expect(2) = 4e-12 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRV---IENGPLVPHLQFDNDTLVF 49 +A+ LSG RV E G L+ HL F +DTLVF Sbjct: 295 RAVEGGYLSGCRVKGRSEEGALISHLLFADDTLVF 329 >emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera] Length = 1034 Score = 67.8 bits (164), Expect(2) = 5e-12 Identities = 30/63 (47%), Positives = 44/63 (69%) Frame = -2 Query: 332 FLEYMVLMLGFGDKWFGRIMKSVTSTLFSILVNGRPAGYFRGSRGLRQGDPLSHFLFVIV 153 F+ ++ +GFG+KW I +++ FS+LV+G P G+F+ S+GLRQGDPLS +LFVI Sbjct: 226 FILTVMQKMGFGEKWIRWIKWCISTASFSVLVBGTPTGFFQSSKGLRQGDPLSPYLFVIA 285 Query: 152 TFV 144 V Sbjct: 286 MXV 288 Score = 28.5 bits (62), Expect(2) = 5e-12 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 144 KAINIWSLSGFRV---IENGPLVPHLQFDNDTLVF 49 +A+ LSG RV E G L+ HL F +DTLVF Sbjct: 295 RAVEGGYLSGCRVKGRSEEGALISHLLFADDTLVF 329