BLASTX nr result
ID: Akebia25_contig00028617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00028617 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293809.1| hypothetical protein CARUB_v10022794mg [Caps... 55 1e-05 ref|XP_002881151.1| GTP binding protein [Arabidopsis lyrata subs... 55 1e-05 >ref|XP_006293809.1| hypothetical protein CARUB_v10022794mg [Capsella rubella] gi|482562517|gb|EOA26707.1| hypothetical protein CARUB_v10022794mg [Capsella rubella] Length = 664 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 42 INPVRMKELTNIRSAGKDENVKLSPPHLVCFQ 137 +NPVR KELTNIRSAGKDENVKLSPP L+ + Sbjct: 593 VNPVRAKELTNIRSAGKDENVKLSPPRLMTLE 624 >ref|XP_002881151.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] gi|297326990|gb|EFH57410.1| GTP binding protein [Arabidopsis lyrata subsp. lyrata] Length = 667 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 42 INPVRMKELTNIRSAGKDENVKLSPPHLVCFQ 137 +NPVR KELTNIRSAGKDENVKLSPP L+ + Sbjct: 596 VNPVRAKELTNIRSAGKDENVKLSPPRLMTLE 627