BLASTX nr result
ID: Akebia25_contig00028320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00028320 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67711.1| hypothetical protein VITISV_020427 [Vitis vinifera] 51 3e-07 >emb|CAN67711.1| hypothetical protein VITISV_020427 [Vitis vinifera] Length = 843 Score = 50.8 bits (120), Expect(3) = 3e-07 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -2 Query: 299 SRLDMFLLFSSWEDHFSSVIQLLVPNPTSDQSPIILEVG 183 +RLD FL+ +W DHFS V+Q +P PTSD PI+LE G Sbjct: 382 ARLDRFLVTQNWLDHFSGVVQSRLPRPTSDHFPILLECG 420 Score = 25.0 bits (53), Expect(3) = 3e-07 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = -1 Query: 126 KLKI*DNEIFGRIELKKEICV 64 K+K+ + E+FGR+E+ K + + Sbjct: 472 KIKVWNREVFGRLEVNKNLAL 492 Score = 23.5 bits (49), Expect(3) = 3e-07 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -3 Query: 160 FKNMWLQHLGFK 125 F+NMWL+ +GFK Sbjct: 431 FENMWLKVVGFK 442