BLASTX nr result
ID: Akebia25_contig00028219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00028219 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 >ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 736 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +3 Query: 48 MILWLELDIYVYNSFLAMYS*FGDMGSIKELFDMMLLQDLTSLNTMKSMY 197 ++ LE DIYV NS LAMY+ FGDMG+ + +FD M +DLTS NTM S Y Sbjct: 188 VVCGLESDIYVGNSLLAMYAKFGDMGTARMVFDRMAERDLTSWNTMISGY 237