BLASTX nr result
ID: Akebia25_contig00028030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00028030 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486949.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-... 62 8e-08 ref|XP_006422860.1| hypothetical protein CICLE_v10028999mg [Citr... 61 1e-07 ref|XP_006379171.1| hypothetical protein POPTR_0009s09440g [Popu... 61 1e-07 >ref|XP_006486949.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Citrus sinensis] Length = 283 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/69 (49%), Positives = 39/69 (56%) Frame = -1 Query: 208 MTSASELFYNRRSRIGRIDTELRFGSSSSLDXXXXXXXXXXXXXXXXXXNVDDCDPLRRS 29 MTSASELFY RRSR+GR D +L S +S ++D CDPLRRS Sbjct: 1 MTSASELFYTRRSRVGRADQDLGLDSFTS---ERGLHNRRHHHNHNHRHDLDGCDPLRRS 57 Query: 28 PHVRHLCHR 2 PH RHL HR Sbjct: 58 PHARHLSHR 66 >ref|XP_006422860.1| hypothetical protein CICLE_v10028999mg [Citrus clementina] gi|557524794|gb|ESR36100.1| hypothetical protein CICLE_v10028999mg [Citrus clementina] Length = 283 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/69 (49%), Positives = 39/69 (56%) Frame = -1 Query: 208 MTSASELFYNRRSRIGRIDTELRFGSSSSLDXXXXXXXXXXXXXXXXXXNVDDCDPLRRS 29 MTSASELFY RRSR+GR D +L S +S ++D CDPLRRS Sbjct: 1 MTSASELFYTRRSRVGRADQDLGLDSFTS---ERGLHNRRHHHNHNHRHDLDGCDPLRRS 57 Query: 28 PHVRHLCHR 2 PH RHL HR Sbjct: 58 PHARHLPHR 66 >ref|XP_006379171.1| hypothetical protein POPTR_0009s09440g [Populus trichocarpa] gi|550331379|gb|ERP56968.1| hypothetical protein POPTR_0009s09440g [Populus trichocarpa] Length = 206 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/69 (47%), Positives = 38/69 (55%) Frame = -1 Query: 208 MTSASELFYNRRSRIGRIDTELRFGSSSSLDXXXXXXXXXXXXXXXXXXNVDDCDPLRRS 29 MTSASELFY RRSR+ R +T+L S S ++D CDPLRRS Sbjct: 1 MTSASELFYQRRSRVSRANTDLGLEPSVSDRIFYQNYNRRHHNNHNHRHDLDGCDPLRRS 60 Query: 28 PHVRHLCHR 2 PHVRH C R Sbjct: 61 PHVRHPCQR 69