BLASTX nr result
ID: Akebia25_contig00027834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027834 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38731.1| hypothetical protein L484_004526 [Morus notabilis] 62 1e-07 ref|XP_002315238.1| hypothetical protein POPTR_0010s21540g [Popu... 58 2e-06 >gb|EXB38731.1| hypothetical protein L484_004526 [Morus notabilis] Length = 187 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 233 LHVCALLCFFVLALISAYRVFSMFEPPVVPSKGVEE 126 LH AL CFFVLA+ISAYRVFSMFEPP VP+K VEE Sbjct: 152 LHASALCCFFVLAVISAYRVFSMFEPPSVPNKDVEE 187 >ref|XP_002315238.1| hypothetical protein POPTR_0010s21540g [Populus trichocarpa] gi|341958558|sp|B9HTL5.1|CSPLC_POPTR RecName: Full=CASP-like protein POPTRDRAFT_833824 gi|222864278|gb|EEF01409.1| hypothetical protein POPTR_0010s21540g [Populus trichocarpa] Length = 170 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 233 LHVCALLCFFVLALISAYRVFSMFEPPVVPSKGVEEE 123 LH AL CF +LA+ISAYR FS+FEPP+VPSK VEE+ Sbjct: 132 LHALALSCFIILAVISAYRAFSIFEPPLVPSKVVEED 168