BLASTX nr result
ID: Akebia25_contig00027748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027748 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827733.1| hypothetical protein AMTR_s00009p00261690 [A... 65 4e-09 ref|XP_006474848.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 7e-09 ref|XP_006467261.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 7e-09 ref|XP_006449944.1| hypothetical protein CICLE_v10015898mg [Citr... 64 7e-09 ref|XP_002522784.1| conserved hypothetical protein [Ricinus comm... 64 8e-09 ref|XP_002270197.1| PREDICTED: SEC14-like protein 5 [Vitis vinif... 64 9e-09 emb|CAN64059.1| hypothetical protein VITISV_000011 [Vitis vinifera] 64 9e-09 ref|XP_003546204.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 9e-09 ref|XP_003534976.1| PREDICTED: phosphatidylinositol/phosphatidyl... 64 9e-09 gb|ACU24288.1| unknown [Glycine max] 64 9e-09 ref|XP_007205505.1| hypothetical protein PRUPE_ppa008306mg [Prun... 64 1e-08 ref|XP_006452627.1| hypothetical protein CICLE_v10008869mg [Citr... 64 1e-08 gb|EXB51017.1| hypothetical protein L484_023719 [Morus notabilis] 64 1e-08 ref|XP_002300384.1| SEC14 cytosolic factor family protein [Popul... 62 3e-08 ref|XP_002307849.1| phosphatidylinositol-phosphatidylcholine tra... 62 4e-08 gb|ADE76504.1| unknown [Picea sitchensis] 62 4e-08 ref|XP_002530426.1| SEC14 cytosolic factor, putative [Ricinus co... 62 4e-08 ref|XP_007147582.1| hypothetical protein PHAVU_006G136700g [Phas... 62 4e-08 ref|XP_004486361.1| PREDICTED: SEC14 cytosolic factor-like [Cice... 63 5e-08 ref|XP_003594312.1| hypothetical protein MTR_2g027140 [Medicago ... 63 5e-08 >ref|XP_006827733.1| hypothetical protein AMTR_s00009p00261690 [Amborella trichopoda] gi|548832353|gb|ERM95149.1| hypothetical protein AMTR_s00009p00261690 [Amborella trichopoda] Length = 305 Score = 65.1 bits (157), Expect(2) = 4e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQGSGRDELLK+ Sbjct: 186 CWKVVKPLLQERTRRKIQVLQGSGRDELLKV 216 Score = 21.2 bits (43), Expect(2) = 4e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 183 FSACWKV 189 >ref|XP_006474848.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like [Citrus sinensis] Length = 334 Score = 64.3 bits (155), Expect(2) = 7e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQG+GRDELLKI Sbjct: 200 CWKVVKPLLQERTRRKIQVLQGNGRDELLKI 230 Score = 21.2 bits (43), Expect(2) = 7e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 197 FSACWKV 203 >ref|XP_006467261.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH1-like [Citrus sinensis] Length = 329 Score = 64.3 bits (155), Expect(2) = 7e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+K+QVLQGSGRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKIQVLQGSGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 7e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >ref|XP_006449944.1| hypothetical protein CICLE_v10015898mg [Citrus clementina] gi|557552555|gb|ESR63184.1| hypothetical protein CICLE_v10015898mg [Citrus clementina] Length = 329 Score = 64.3 bits (155), Expect(2) = 7e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+K+QVLQGSGRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKIQVLQGSGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 7e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >ref|XP_002522784.1| conserved hypothetical protein [Ricinus communis] gi|223538022|gb|EEF39635.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 64.3 bits (155), Expect(2) = 8e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKIRWS 239 CWKVVKPLLQERTRRK+QVLQG GRDELLK R S Sbjct: 74 CWKVVKPLLQERTRRKIQVLQGCGRDELLKARLS 107 Score = 21.2 bits (43), Expect(2) = 8e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 71 FSACWKV 77 >ref|XP_002270197.1| PREDICTED: SEC14-like protein 5 [Vitis vinifera] gi|296089941|emb|CBI39760.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 63.9 bits (154), Expect(2) = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVLQG GRDELLKI Sbjct: 202 CWKVVKPLLQERTRRKVQVLQGCGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 9e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >emb|CAN64059.1| hypothetical protein VITISV_000011 [Vitis vinifera] Length = 338 Score = 63.9 bits (154), Expect(2) = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVLQG GRDELLKI Sbjct: 202 CWKVVKPLLQERTRRKVQVLQGCGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 9e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >ref|XP_003546204.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Glycine max] Length = 329 Score = 63.9 bits (154), Expect(2) = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVLQG GRDELLKI Sbjct: 205 CWKVVKPLLQERTRRKVQVLQGCGRDELLKI 235 Score = 21.2 bits (43), Expect(2) = 9e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 202 FSACWKV 208 >ref|XP_003534976.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH9-like [Glycine max] Length = 329 Score = 63.9 bits (154), Expect(2) = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVLQG GRDELLKI Sbjct: 205 CWKVVKPLLQERTRRKVQVLQGCGRDELLKI 235 Score = 21.2 bits (43), Expect(2) = 9e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 202 FSACWKV 208 >gb|ACU24288.1| unknown [Glycine max] Length = 329 Score = 63.9 bits (154), Expect(2) = 9e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVLQG GRDELLKI Sbjct: 205 CWKVVKPLLQERTRRKVQVLQGCGRDELLKI 235 Score = 21.2 bits (43), Expect(2) = 9e-09 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 202 FSACWKV 208 >ref|XP_007205505.1| hypothetical protein PRUPE_ppa008306mg [Prunus persica] gi|462401147|gb|EMJ06704.1| hypothetical protein PRUPE_ppa008306mg [Prunus persica] Length = 337 Score = 63.5 bits (153), Expect(2) = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQG GRDELLKI Sbjct: 202 CWKVVKPLLQERTRRKIQVLQGCGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >ref|XP_006452627.1| hypothetical protein CICLE_v10008869mg [Citrus clementina] gi|557555853|gb|ESR65867.1| hypothetical protein CICLE_v10008869mg [Citrus clementina] Length = 334 Score = 63.5 bits (153), Expect(2) = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQG+GRDELLKI Sbjct: 200 CWKVVKPLLQERTRRKMQVLQGNGRDELLKI 230 Score = 21.2 bits (43), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 197 FSACWKV 203 >gb|EXB51017.1| hypothetical protein L484_023719 [Morus notabilis] Length = 310 Score = 63.5 bits (153), Expect(2) = 1e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQG GRDELLKI Sbjct: 184 CWKVVKPLLQERTRRKIQVLQGCGRDELLKI 214 Score = 21.2 bits (43), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 181 FSACWKV 187 >ref|XP_002300384.1| SEC14 cytosolic factor family protein [Populus trichocarpa] gi|222847642|gb|EEE85189.1| SEC14 cytosolic factor family protein [Populus trichocarpa] Length = 337 Score = 62.4 bits (150), Expect(2) = 3e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+K+QVLQG GRDELLKI Sbjct: 204 CWKVVKPLLQERTRKKIQVLQGCGRDELLKI 234 Score = 21.2 bits (43), Expect(2) = 3e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 201 FSACWKV 207 >ref|XP_002307849.1| phosphatidylinositol-phosphatidylcholine transfer protein SEC14 Ssh1 [Populus trichocarpa] gi|222853825|gb|EEE91372.1| phosphatidylinositol-phosphatidylcholine transfer protein SEC14 Ssh1 [Populus trichocarpa] Length = 345 Score = 61.6 bits (148), Expect(2) = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+KVQVL G+GRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKVQVLSGNGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >gb|ADE76504.1| unknown [Picea sitchensis] Length = 342 Score = 61.6 bits (148), Expect(2) = 4e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRK+QVLQG GR+ELLK+ Sbjct: 203 CWKVVKPLLQERTRRKIQVLQGCGREELLKV 233 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 200 FSACWKV 206 >ref|XP_002530426.1| SEC14 cytosolic factor, putative [Ricinus communis] gi|223530034|gb|EEF31957.1| SEC14 cytosolic factor, putative [Ricinus communis] Length = 336 Score = 61.6 bits (148), Expect(2) = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+KVQVL G+GRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKVQVLSGNGRDELLKI 232 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 199 FSACWKV 205 >ref|XP_007147582.1| hypothetical protein PHAVU_006G136700g [Phaseolus vulgaris] gi|561020805|gb|ESW19576.1| hypothetical protein PHAVU_006G136700g [Phaseolus vulgaris] Length = 332 Score = 61.6 bits (148), Expect(2) = 4e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTRRKVQVL G GRDELLKI Sbjct: 204 CWKVVKPLLQERTRRKVQVLPGCGRDELLKI 234 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 2 FSACWKV 22 FSACWKV Sbjct: 201 FSACWKV 207 >ref|XP_004486361.1| PREDICTED: SEC14 cytosolic factor-like [Cicer arietinum] Length = 327 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+KVQVLQG GRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKVQVLQGCGRDELLKI 232 >ref|XP_003594312.1| hypothetical protein MTR_2g027140 [Medicago truncatula] gi|87162791|gb|ABD28586.1| Cellular retinaldehyde binding/alpha-tocopherol transport; Cellular retinaldehyde-binding/triple function, N-terminal [Medicago truncatula] gi|355483360|gb|AES64563.1| hypothetical protein MTR_2g027140 [Medicago truncatula] Length = 328 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 138 CWKVVKPLLQERTRRKVQVLQGSGRDELLKI 230 CWKVVKPLLQERTR+KVQVLQG GRDELLKI Sbjct: 202 CWKVVKPLLQERTRKKVQVLQGCGRDELLKI 232