BLASTX nr result
ID: Akebia25_contig00027707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027707 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF75878.1| hypothetical protein EPUS_01244 [Endocarpon pusil... 62 8e-08 ref|XP_002793343.1| parasitic phase-specific protein PSP-1 [Para... 60 2e-07 gb|EQL30132.1| hypothetical protein BDFG_07315 [Ajellomyces derm... 60 3e-07 gb|EME84187.1| hypothetical protein MYCFIDRAFT_135704 [Pseudocer... 60 3e-07 gb|EGE84560.1| parasitic phase-specific protein PSP-1 [Ajellomyc... 60 3e-07 gb|EEQ84644.1| parasitic phase-specific protein PSP-1 [Ajellomyc... 60 3e-07 ref|XP_002625277.1| parasitic phase-specific protein PSP-1 [Ajel... 60 3e-07 ref|XP_002847715.1| parasitic phase-specific protein PSP-1 [Arth... 60 3e-07 ref|XP_001542697.1| predicted protein [Ajellomyces capsulatus NA... 60 3e-07 gb|EKG10348.1| Major facilitator superfamily [Macrophomina phase... 59 5e-07 ref|XP_003176286.1| hypothetical protein MGYG_00373 [Arthroderma... 59 7e-07 gb|EEH46513.1| parasitic phase-specific protein PSP-1 [Paracocci... 59 9e-07 gb|EEH17647.1| conserved hypothetical protein [Paracoccidioides ... 59 9e-07 dbj|GAD96682.1| RTA1 domain protein, putative [Byssochlamys spec... 58 1e-06 gb|EER39141.1| parasitic phase-specific protein PSP-1 [Ajellomyc... 58 1e-06 gb|EPE25468.1| hypothetical protein GLAREA_01380 [Glarea lozoyen... 58 2e-06 ref|XP_002846384.1| conserved hypothetical protein [Arthroderma ... 58 2e-06 gb|EZG01138.1| hypothetical protein H106_08478 [Trichophyton rub... 57 2e-06 ref|XP_003239172.1| sphingoid long-chain base transporter RSB1 [... 57 2e-06 ref|XP_003018868.1| RTA1 domain protein, putative [Trichophyton ... 57 2e-06 >gb|ERF75878.1| hypothetical protein EPUS_01244 [Endocarpon pusillum Z07020] Length = 273 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF----HKASKNAFAEEEMS 118 AE++GGWGN IM++E + I LDSVMI +S L + IFHPG CF +A ++ ++ E Sbjct: 190 AEMAGGWGNSIMQSELDFIVLDSVMITISVLAMTIFHPGYCFPQMVSQAKRSRLSDIEKK 249 Query: 117 TPMGHGSVQEEA 82 T SV+E + Sbjct: 250 T-SSETSVEESS 260 >ref|XP_002793343.1| parasitic phase-specific protein PSP-1 [Paracoccidioides sp. 'lutzii' Pb01] gi|226278257|gb|EEH33823.1| parasitic phase-specific protein PSP-1 [Paracoccidioides sp. 'lutzii' Pb01] Length = 309 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAEEE 124 AELSGGW +MK+E IAL+ VM+ ++ LVLN FHPGRCF K + + EEE Sbjct: 252 AELSGGWDGHLMKDEPLFIALEGVMVGLAVLVLNAFHPGRCF-KETPDVIDEEE 304 >gb|EQL30132.1| hypothetical protein BDFG_07315 [Ajellomyces dermatitidis ATCC 26199] gi|531979546|gb|EQL30133.1| hypothetical protein, variant 1 [Ajellomyces dermatitidis ATCC 26199] gi|531979547|gb|EQL30134.1| hypothetical protein, variant 2 [Ajellomyces dermatitidis ATCC 26199] Length = 325 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELSGGW P++K+E I L+ VM+ ++ LVLN FHPGRCF Sbjct: 253 AELSGGWDGPLLKDEPLFIGLEGVMVALAVLVLNAFHPGRCF 294 >gb|EME84187.1| hypothetical protein MYCFIDRAFT_135704 [Pseudocercospora fijiensis CIRAD86] Length = 257 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 8/65 (12%) Frame = -1 Query: 282 ELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF----HKASKNAFAEE---- 127 E++GGWGNP+M+NE E + LD MI ++ ++L + HPG F +KASK A E Sbjct: 186 EMAGGWGNPLMRNEKEFLILDGTMIAIATVLLTVAHPGIFFPAMRNKASKEASQREVKDV 245 Query: 126 EMSTP 112 E+STP Sbjct: 246 ELSTP 250 >gb|EGE84560.1| parasitic phase-specific protein PSP-1 [Ajellomyces dermatitidis ATCC 18188] Length = 325 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELSGGW P++K+E I L+ VM+ ++ LVLN FHPGRCF Sbjct: 253 AELSGGWDGPLLKDEPLFIGLEGVMVALAVLVLNAFHPGRCF 294 >gb|EEQ84644.1| parasitic phase-specific protein PSP-1 [Ajellomyces dermatitidis ER-3] Length = 330 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELSGGW P++K+E I L+ VM+ ++ LVLN FHPGRCF Sbjct: 258 AELSGGWDGPLLKDEPLFIGLEGVMVALAVLVLNAFHPGRCF 299 >ref|XP_002625277.1| parasitic phase-specific protein PSP-1 [Ajellomyces dermatitidis SLH14081] gi|239595240|gb|EEQ77821.1| parasitic phase-specific protein PSP-1 [Ajellomyces dermatitidis SLH14081] Length = 330 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELSGGW P++K+E I L+ VM+ ++ LVLN FHPGRCF Sbjct: 258 AELSGGWDGPLLKDEPLFIGLEGVMVALAVLVLNAFHPGRCF 299 >ref|XP_002847715.1| parasitic phase-specific protein PSP-1 [Arthroderma otae CBS 113480] gi|238840740|gb|EEQ30402.1| parasitic phase-specific protein PSP-1 [Arthroderma otae CBS 113480] Length = 313 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELS GW P++ NEG I ++SV +VVS L+LN FHP RCF Sbjct: 257 AELSEGWDGPLLSNEGLFIGMESVFVVVSVLILNAFHPSRCF 298 >ref|XP_001542697.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150410877|gb|EDN06265.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 308 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAEEEMSTP 112 AELSGGW P++K+E I L+S+MIV++ALVLN FHPG F +A+ + E + P Sbjct: 251 AELSGGWDGPLLKDEPLFIGLESIMIVLAALVLNAFHPGWGFGRAANASEVELKRLVP 308 >gb|EKG10348.1| Major facilitator superfamily [Macrophomina phaseolina MS6] Length = 316 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -1 Query: 282 ELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFH 157 E++GGW NPIM+NE I LDS + ++ALVL +FHPG CF+ Sbjct: 205 EMAGGWKNPIMQNEASFIVLDSSLCSLAALVLTVFHPGHCFN 246 >ref|XP_003176286.1| hypothetical protein MGYG_00373 [Arthroderma gypseum CBS 118893] gi|311338132|gb|EFQ97334.1| hypothetical protein MGYG_00373 [Arthroderma gypseum CBS 118893] Length = 307 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELS GW P++ NEG I ++SV +V+S L+LN FHP RCF Sbjct: 256 AELSEGWDGPLLSNEGLFIGMESVFVVISVLLLNAFHPSRCF 297 >gb|EEH46513.1| parasitic phase-specific protein PSP-1 [Paracoccidioides brasiliensis Pb18] Length = 309 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAEE 127 AELSGGW +MK+E IAL+ VM+ ++ LVLN FHPGRCF K + + EE Sbjct: 252 AELSGGWDGHLMKDEPLFIALEGVMVGLAVLVLNAFHPGRCF-KETPDVIDEE 303 >gb|EEH17647.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03] Length = 309 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAEE 127 AELSGGW +MK+E IAL+ VM+ ++ LVLN FHPGRCF K + + EE Sbjct: 252 AELSGGWDGHLMKDEPLFIALEGVMVGLAVLVLNAFHPGRCF-KETPDVIDEE 303 >dbj|GAD96682.1| RTA1 domain protein, putative [Byssochlamys spectabilis No. 5] Length = 326 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 5/79 (6%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASK-NAFAEEEMSTPM 109 AE++GGWGNP+M+NEG IAL+ VM++ A++L+ F PG F + SK + E+E + + Sbjct: 245 AEMAGGWGNPVMQNEGLFIALEGVMVLYPAVLLSTFSPGIFFPQMSKLRSDYEKETAAAL 304 Query: 108 GH----GSVQEEAYAKQPG 64 GS++E Q G Sbjct: 305 NEQSSSGSLREADTGVQAG 323 >gb|EER39141.1| parasitic phase-specific protein PSP-1 [Ajellomyces capsulatus H143] gi|325091461|gb|EGC44771.1| parasitic phase-specific protein PSP-1 [Ajellomyces capsulatus H88] Length = 308 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAE 130 AELSGGW P++K+E I L+SVMIV++ LVLN FHPG F +A+ + E Sbjct: 251 AELSGGWDGPLLKDEPLFIGLESVMIVLAVLVLNAFHPGWGFGRAANASEVE 302 >gb|EPE25468.1| hypothetical protein GLAREA_01380 [Glarea lozoyensis ATCC 20868] Length = 308 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAE 130 AE++GGW NPIM++E I LDSVM +V+ LV+N++HPG F ++ AE Sbjct: 244 AEMAGGWRNPIMQDEIAFIVLDSVMCIVACLVVNVWHPGFLFQQSYATTKAE 295 >ref|XP_002846384.1| conserved hypothetical protein [Arthroderma otae CBS 113480] gi|238841640|gb|EEQ31302.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 308 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/70 (32%), Positives = 40/70 (57%) Frame = -1 Query: 282 ELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCFHKASKNAFAEEEMSTPMGH 103 E++GGWGNP+M+NE + + LD +MI +++ +FHPG F K +++ P Sbjct: 239 EMAGGWGNPLMRNEKDFLLLDGMMIALASATFTVFHPGFWFPPMRKGGLSKDAQFVPPSE 298 Query: 102 GSVQEEAYAK 73 G+ ++ K Sbjct: 299 GTSVNDSTEK 308 >gb|EZG01138.1| hypothetical protein H106_08478 [Trichophyton rubrum CBS 735.88] Length = 305 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELS GW P++ NEG I ++SV +V+S +LN FHP RCF Sbjct: 256 AELSEGWDGPLLSNEGLFIGMESVFVVISVFLLNAFHPSRCF 297 >ref|XP_003239172.1| sphingoid long-chain base transporter RSB1 [Trichophyton rubrum CBS 118892] gi|326459428|gb|EGD84881.1| sphingoid long-chain base transporter RSB1 [Trichophyton rubrum CBS 118892] gi|607864572|gb|EZF10060.1| hypothetical protein H100_08620 [Trichophyton rubrum MR850] gi|607899180|gb|EZF36985.1| hypothetical protein H102_08579 [Trichophyton rubrum CBS 100081] gi|607911302|gb|EZF47601.1| hypothetical protein H103_08602 [Trichophyton rubrum CBS 288.86] gi|607923415|gb|EZF58277.1| hypothetical protein H104_08554 [Trichophyton rubrum CBS 289.86] gi|607935261|gb|EZF68823.1| hypothetical protein H105_08607 [Trichophyton soudanense CBS 452.61] gi|607947257|gb|EZF79498.1| hypothetical protein H110_08603 [Trichophyton rubrum MR1448] gi|607959260|gb|EZF90027.1| hypothetical protein H113_08671 [Trichophyton rubrum MR1459] gi|607983426|gb|EZG11768.1| hypothetical protein H107_08758 [Trichophyton rubrum CBS 202.88] Length = 305 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELS GW P++ NEG I ++SV +V+S +LN FHP RCF Sbjct: 256 AELSEGWDGPLLSNEGLFIGMESVFVVISVFLLNAFHPSRCF 297 >ref|XP_003018868.1| RTA1 domain protein, putative [Trichophyton verrucosum HKI 0517] gi|291182550|gb|EFE38223.1| RTA1 domain protein, putative [Trichophyton verrucosum HKI 0517] Length = 305 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 285 AELSGGWGNPIMKNEGELIALDSVMIVVSALVLNIFHPGRCF 160 AELS GW P++ NEG I ++SV +V+S +LN FHP RCF Sbjct: 256 AELSEGWDGPLLSNEGLFIGMESVFVVISVFLLNAFHPSRCF 297