BLASTX nr result
ID: Akebia25_contig00027527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027527 (596 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20898.1| Clp protease-related protein [Morus notabilis] 66 8e-09 ref|XP_006856238.1| hypothetical protein AMTR_s00059p00213590 [A... 66 8e-09 ref|XP_007218298.1| hypothetical protein PRUPE_ppa010759mg [Prun... 66 8e-09 ref|XP_007038471.1| Double Clp-N motif protein [Theobroma cacao]... 65 2e-08 ref|XP_004306484.1| PREDICTED: clp protease-related protein At4g... 64 2e-08 ref|XP_006374654.1| hypothetical protein POPTR_0015s14320g [Popu... 63 7e-08 ref|XP_002321851.1| Clp amino terminal domain-containing family ... 63 7e-08 ref|NP_001241043.1| uncharacterized protein LOC100786069 [Glycin... 62 9e-08 ref|XP_002268037.2| PREDICTED: clp protease-related protein At4g... 62 9e-08 emb|CAN60931.1| hypothetical protein VITISV_006813 [Vitis vinifera] 62 9e-08 gb|EYU25008.1| hypothetical protein MIMGU_mgv1a012964mg [Mimulus... 62 1e-07 ref|NP_001242487.1| uncharacterized protein LOC100786582 [Glycin... 62 1e-07 ref|XP_003534040.1| PREDICTED: clp protease-related protein At4g... 62 2e-07 ref|XP_002318870.2| hypothetical protein POPTR_0012s14320g [Popu... 61 2e-07 ref|XP_007152401.1| hypothetical protein PHAVU_004G127000g [Phas... 61 3e-07 ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g... 60 6e-07 ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citr... 60 6e-07 ref|XP_002510906.1| ATP-dependent clp protease, putative [Ricinu... 60 6e-07 gb|ABK23916.1| unknown [Picea sitchensis] gi|224285995|gb|ACN407... 60 6e-07 ref|XP_007040016.1| Double Clp-N motif protein [Theobroma cacao]... 59 8e-07 >gb|EXC20898.1| Clp protease-related protein [Morus notabilis] Length = 257 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVD+KLKS ESGE T + L IWSEKES Sbjct: 164 HPPLTEPAQRALDWAVDQKLKSGESGEITTAHLLLGIWSEKES 206 >ref|XP_006856238.1| hypothetical protein AMTR_s00059p00213590 [Amborella trichopoda] gi|548860097|gb|ERN17705.1| hypothetical protein AMTR_s00059p00213590 [Amborella trichopoda] Length = 241 Score = 65.9 bits (159), Expect = 8e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVDEK+KS E GE T T+ L IWS+KES Sbjct: 167 HPPLTEPAQRALDWAVDEKMKSGEDGEVTNTHLLLGIWSQKES 209 >ref|XP_007218298.1| hypothetical protein PRUPE_ppa010759mg [Prunus persica] gi|462414760|gb|EMJ19497.1| hypothetical protein PRUPE_ppa010759mg [Prunus persica] Length = 237 Score = 65.9 bits (159), Expect = 8e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVD+KLKS E+GE T T+ L IWSEKES Sbjct: 164 HPPLTEPAQRALDWAVDQKLKSGENGEITVTHLLLGIWSEKES 206 >ref|XP_007038471.1| Double Clp-N motif protein [Theobroma cacao] gi|508775716|gb|EOY22972.1| Double Clp-N motif protein [Theobroma cacao] Length = 230 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWAVDEKLKS ESGE T T L IWSEKES Sbjct: 156 HPPLTEQAQRALDWAVDEKLKSGESGEITTTYLLLGIWSEKES 198 >ref|XP_004306484.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 225 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVD+KLKS +SGE T ++ L IWSEKES Sbjct: 151 HPPLTEPAQRALDWAVDQKLKSGDSGEITVSHLLLGIWSEKES 193 >ref|XP_006374654.1| hypothetical protein POPTR_0015s14320g [Populus trichocarpa] gi|550322700|gb|ERP52451.1| hypothetical protein POPTR_0015s14320g [Populus trichocarpa] Length = 229 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWA++EKLKS +SGE T T+ L IWSEKES Sbjct: 155 HPPLTEQAQRALDWAIEEKLKSGDSGEITTTHILLGIWSEKES 197 >ref|XP_002321851.1| Clp amino terminal domain-containing family protein [Populus trichocarpa] gi|222868847|gb|EEF05978.1| Clp amino terminal domain-containing family protein [Populus trichocarpa] Length = 160 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWA++EKLKS +SGE T T+ L IWSEKES Sbjct: 86 HPPLTEQAQRALDWAIEEKLKSGDSGEITTTHILLGIWSEKES 128 >ref|NP_001241043.1| uncharacterized protein LOC100786069 [Glycine max] gi|255641314|gb|ACU20934.1| unknown [Glycine max] Length = 252 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWA++EKLKS E GE T+ L IWS+KES Sbjct: 183 HPPLTEPAQKALDWAIEEKLKSGEGGEINATHLLLGIWSQKES 225 >ref|XP_002268037.2| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Vitis vinifera] gi|296084123|emb|CBI24511.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVDEK+KS E GE T ++ L IW+E+ES Sbjct: 158 HPPLTEPAQRALDWAVDEKIKSGEEGEITTSHLLLGIWAEEES 200 >emb|CAN60931.1| hypothetical protein VITISV_006813 [Vitis vinifera] Length = 231 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAVDEK+KS E GE T ++ L IW+E+ES Sbjct: 158 HPPLTEPAQRALDWAVDEKIKSGEEGEITTSHLLLGIWAEEES 200 >gb|EYU25008.1| hypothetical protein MIMGU_mgv1a012964mg [Mimulus guttatus] Length = 234 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWAV+EKLKS +SGE T + + IWS+KES Sbjct: 160 HPPLTEPAQRALDWAVEEKLKSGDSGEITSAHLVLGIWSQKES 202 >ref|NP_001242487.1| uncharacterized protein LOC100786582 [Glycine max] gi|255639105|gb|ACU19852.1| unknown [Glycine max] Length = 260 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWA++EKLKS E GE + T+ L IWS+KES Sbjct: 183 HPPLTEPAQKALDWAIEEKLKSGEGGEISVTHLLLGIWSQKES 225 >ref|XP_003534040.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like isoform X1 [Glycine max] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPAQ ALDWA++EKLKS E GE T+ L IWS+KES Sbjct: 175 HPPLTEPAQKALDWAIEEKLKSGEGGEINVTHLLLGIWSQKES 217 >ref|XP_002318870.2| hypothetical protein POPTR_0012s14320g [Populus trichocarpa] gi|550327110|gb|EEE97090.2| hypothetical protein POPTR_0012s14320g [Populus trichocarpa] Length = 229 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWAV+EKLKS +SGE T T+ L WSEKES Sbjct: 155 HPPLTEQAQRALDWAVEEKLKSGDSGEITTTHILLGTWSEKES 197 >ref|XP_007152401.1| hypothetical protein PHAVU_004G127000g [Phaseolus vulgaris] gi|561025710|gb|ESW24395.1| hypothetical protein PHAVU_004G127000g [Phaseolus vulgaris] Length = 234 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTEPA+ ALDWA++EKLKS E GE T+ L IWS+KES Sbjct: 157 HPPLTEPAKSALDWAIEEKLKSGEGGEMNVTHILLGIWSQKES 199 >ref|XP_006490254.1| PREDICTED: clp protease-related protein At4g12060, chloroplastic-like [Citrus sinensis] Length = 233 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -3 Query: 303 PPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 PPLTE AQ ALDWA +EKLKS ESGE T + L IWSEKES Sbjct: 160 PPLTEQAQRALDWAFNEKLKSGESGEITTNHLLLGIWSEKES 201 >ref|XP_006421758.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] gi|557523631|gb|ESR34998.1| hypothetical protein CICLE_v10005783mg [Citrus clementina] Length = 233 Score = 59.7 bits (143), Expect = 6e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -3 Query: 303 PPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 PPLTE AQ ALDWA +EKLKS ESGE T + L IWSEKES Sbjct: 160 PPLTEQAQRALDWAFNEKLKSGESGEITTNHLLLGIWSEKES 201 >ref|XP_002510906.1| ATP-dependent clp protease, putative [Ricinus communis] gi|223550021|gb|EEF51508.1| ATP-dependent clp protease, putative [Ricinus communis] Length = 227 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWA+DEKLKS + GE T T+ L IWSE ES Sbjct: 153 HPPLTEQAQRALDWAIDEKLKSGDDGEITTTHILLGIWSEIES 195 >gb|ABK23916.1| unknown [Picea sitchensis] gi|224285995|gb|ACN40709.1| unknown [Picea sitchensis] Length = 255 Score = 59.7 bits (143), Expect = 6e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEK 184 +P LTEPAQ ALDWAVDEK+KS ESGE T T+ L IW++K Sbjct: 181 HPTLTEPAQKALDWAVDEKIKSGESGEVTTTHMLLGIWAQK 221 >ref|XP_007040016.1| Double Clp-N motif protein [Theobroma cacao] gi|508777261|gb|EOY24517.1| Double Clp-N motif protein [Theobroma cacao] Length = 233 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 306 NPPLTEPAQWALDWAVDEKLKSCESGERTRTNSLTSIWSEKES 178 +PPLTE AQ ALDWAVD+KLKS + GE T T+ L IWSE ES Sbjct: 163 HPPLTEAAQRALDWAVDQKLKSGDDGEVTTTHLLLGIWSEVES 205