BLASTX nr result
ID: Akebia25_contig00027446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027446 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_664192.1| hypothetical protein AN6588.2 [Aspergillus nidu... 57 2e-06 ref|XP_002479751.1| conserved hypothetical protein [Talaromyces ... 56 4e-06 >ref|XP_664192.1| hypothetical protein AN6588.2 [Aspergillus nidulans FGSC A4] gi|40738927|gb|EAA58117.1| hypothetical protein AN6588.2 [Aspergillus nidulans FGSC A4] gi|259480165|tpe|CBF71047.1| TPA: hypothetical protein ANIA_06588 [Aspergillus nidulans FGSC A4] Length = 181 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = +2 Query: 50 MSPHSENLPAYQETESDRFQSLDLERIGGLKEKEIEARW 166 + P+++ LP YQ T++DRFQSLD+ER+GGLKEK+ RW Sbjct: 142 LEPYNDQLPPYQSTDADRFQSLDIERMGGLKEKDDTKRW 180 >ref|XP_002479751.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218719898|gb|EED19317.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 165 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 50 MSPHSENLPAYQETESDRFQSLDLERIGGLKEKEIEARW 166 +SP + LP YQ ES RFQSLDLER+GGLKEKE RW Sbjct: 126 LSPAQDELPPYQTNESGRFQSLDLERMGGLKEKEETKRW 164