BLASTX nr result
ID: Akebia25_contig00027249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027249 (764 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007044728.1| Nitrate transporter2.5 isoform 3, partial [T... 58 4e-06 >ref|XP_007044728.1| Nitrate transporter2.5 isoform 3, partial [Theobroma cacao] gi|508708663|gb|EOY00560.1| Nitrate transporter2.5 isoform 3, partial [Theobroma cacao] Length = 451 Score = 57.8 bits (138), Expect = 4e-06 Identities = 31/43 (72%), Positives = 33/43 (76%), Gaps = 7/43 (16%) Frame = -2 Query: 763 ITVMIAFSLFVQAACGLTFGVVPFISRRQVFLL-------CLN 656 I VMIAFSLFVQAACGLTFGVVPFISRR + +L CLN Sbjct: 355 IAVMIAFSLFVQAACGLTFGVVPFISRRGIEILQPITNQFCLN 397