BLASTX nr result
ID: Akebia25_contig00027005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00027005 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME84761.1| hypothetical protein MYCFIDRAFT_210972 [Pseudocer... 71 2e-10 gb|EKG21490.1| Acyl-CoA oxidase [Macrophomina phaseolina MS6] 69 7e-10 ref|XP_007586542.1| putative acyl- oxidase protein [Neofusicoccu... 68 2e-09 gb|ELR07708.1| acyl-CoA oxidase [Pseudogymnoascus destructans 20... 66 4e-09 gb|EON62833.1| acyl-CoA oxidase [Coniosporium apollinis CBS 100218] 65 1e-08 gb|EWZ78239.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. lycop... 65 1e-08 gb|ENH67849.1| Peroxisomal acyl-coenzyme A oxidase 1 [Fusarium o... 65 1e-08 gb|EMT67075.1| Peroxisomal acyl-coenzyme A oxidase 1 [Fusarium o... 65 1e-08 gb|EGU78901.1| hypothetical protein FOXB_10593 [Fusarium oxyspor... 65 1e-08 ref|XP_003049041.1| predicted protein [Nectria haematococca mpVI... 64 2e-08 gb|EYB30953.1| hypothetical protein FG05_02287 [Fusarium gramine... 64 2e-08 ref|XP_382463.1| hypothetical protein FG02287.1 [Fusarium gramin... 64 2e-08 gb|ETN36442.1| hypothetical protein HMPREF1541_08720 [Cyphelloph... 64 3e-08 emb|CCT67939.1| related to POX1-acyl-CoA oxidase [Fusarium fujik... 63 4e-08 gb|EKJ76068.1| hypothetical protein FPSE_03840 [Fusarium pseudog... 63 5e-08 gb|EHY56217.1| acyl-CoA oxidase [Exophiala dermatitidis NIH/UT8656] 62 1e-07 gb|EQB50569.1| hypothetical protein CGLO_09961 [Colletotrichum g... 61 1e-07 gb|EWG53583.1| acyl-CoA oxidase [Fusarium verticillioides 7600] 61 2e-07 gb|ENH84662.1| acyl-oxidase [Colletotrichum orbiculare MAFF 240422] 61 2e-07 gb|EME44414.1| hypothetical protein DOTSEDRAFT_44640 [Dothistrom... 61 2e-07 >gb|EME84761.1| hypothetical protein MYCFIDRAFT_210972 [Pseudocercospora fijiensis CIRAD86] Length = 711 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = +2 Query: 167 QTPTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 QT PVP WV+KL+P G G+ELLA ER +S + V++L+ ++FGKEALE K K+LK Sbjct: 3 QTAAPVPDWVRKLKPSGPQGTELLANERKQSSVNVEKLSQFMFGKEALERKEKVLK 58 >gb|EKG21490.1| Acyl-CoA oxidase [Macrophomina phaseolina MS6] Length = 702 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = +2 Query: 158 MAPQTPTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 MAP PTP WVK L+P G G ELLA+ERA+S +PV++L+ +LF KEALE K ++LK Sbjct: 1 MAPIVPTP--DWVKALKPSGPQGHELLAKERAQSNVPVEKLSQFLFSKEALERKRRVLK 57 >ref|XP_007586542.1| putative acyl- oxidase protein [Neofusicoccum parvum UCRNP2] gi|485919770|gb|EOD45987.1| putative acyl- oxidase protein [Neofusicoccum parvum UCRNP2] Length = 702 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +2 Query: 158 MAPQTPTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 MAP PTP WVK L+P G G ELLA+ERA+S +PV++L+ +LF KEALE K ++L+ Sbjct: 1 MAPIVPTP--DWVKALKPSGIQGHELLAKERAQSSIPVEKLSEFLFSKEALERKRRVLQ 57 >gb|ELR07708.1| acyl-CoA oxidase [Pseudogymnoascus destructans 20631-21] Length = 698 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 179 PVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKIL 331 P P WV KL P G GSELLA ERAKS + + +L++++FGKEALE +AKIL Sbjct: 4 PPPDWVAKLTPSGPQGSELLATERAKSNINIDKLSSFMFGKEALENEAKIL 54 >gb|EON62833.1| acyl-CoA oxidase [Coniosporium apollinis CBS 100218] Length = 699 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +2 Query: 176 TPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 +P PAWVK+L P G G ELL QER KS +PV +L+ +LF KE LE K ++LK Sbjct: 2 SPTPAWVKQLTPSGPQGHELLKQEREKSNVPVDKLSAFLFTKEVLERKRRVLK 54 >gb|EWZ78239.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. lycopersici MN25] Length = 171 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L+P G GSELLAQERA S + V +L+ +LF KE LE KILK Sbjct: 2 PPPNPDWVKALKPSGPQGSELLAQERANSDINVDQLSTFLFTKEVLERNDKILK 55 >gb|ENH67849.1| Peroxisomal acyl-coenzyme A oxidase 1 [Fusarium oxysporum f. sp. cubense race 1] Length = 662 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L+P G GSELLAQERA S + V +L+ +LF KE LE KILK Sbjct: 2 PPPNPDWVKALKPSGPQGSELLAQERANSDINVDQLSTFLFTKEVLERNDKILK 55 >gb|EMT67075.1| Peroxisomal acyl-coenzyme A oxidase 1 [Fusarium oxysporum f. sp. cubense race 4] Length = 698 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L+P G GSELLAQERA S + V +L+ +LF KE LE KILK Sbjct: 2 PPPNPDWVKALKPSGPQGSELLAQERANSDINVDQLSTFLFTKEVLERNDKILK 55 >gb|EGU78901.1| hypothetical protein FOXB_10593 [Fusarium oxysporum Fo5176] gi|587678976|gb|EWZ01294.1| acyl-CoA oxidase [Fusarium oxysporum FOSC 3-a] gi|587700734|gb|EWZ47339.1| acyl-CoA oxidase [Fusarium oxysporum Fo47] gi|587745371|gb|EXA43087.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. pisi HDV247] gi|590042802|gb|EXK44660.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. melonis 26406] gi|590052106|gb|EXK79630.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. raphani 54005] gi|591405934|gb|EXL41071.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591437482|gb|EXL70274.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591460824|gb|EXL92408.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591490270|gb|EXM19935.1| acyl-CoA oxidase [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 698 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L+P G GSELLAQERA S + V +L+ +LF KE LE KILK Sbjct: 2 PPPNPDWVKALKPSGPQGSELLAQERANSDINVDQLSTFLFTKEVLERNDKILK 55 >ref|XP_003049041.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256729976|gb|EEU43328.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 698 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKIL 331 P P P WVK L+P G GSELL QERAKS + V +L ++LF KE LE AKIL Sbjct: 2 PPPNPDWVKALKPSGPQGSELLEQERAKSAVNVDQLADFLFTKEVLERNAKIL 54 >gb|EYB30953.1| hypothetical protein FG05_02287 [Fusarium graminearum] Length = 696 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L P G GSEL+A+ERA+S + V +L +LF KE LE AKILK Sbjct: 2 PPPNPDWVKALTPSGPQGSELIAKERAQSDINVDQLATFLFTKEVLERNAKILK 55 >ref|XP_382463.1| hypothetical protein FG02287.1 [Fusarium graminearum PH-1] gi|558857627|gb|ESU07710.1| hypothetical protein FGSG_02287 [Fusarium graminearum PH-1] Length = 696 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L P G GSEL+A+ERA+S + V +L +LF KE LE AKILK Sbjct: 2 PPPNPDWVKALTPSGPQGSELIAKERAQSDINVDQLATFLFTKEVLERNAKILK 55 >gb|ETN36442.1| hypothetical protein HMPREF1541_08720 [Cyphellophora europaea CBS 101466] Length = 698 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +2 Query: 185 PAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 PAWVK L+P G GSELL+QERAKS L + +L +YLF KE L +A+IL+ Sbjct: 5 PAWVKALKPSGPQGSELLSQERAKSNLNIDQLADYLFTKEELAKRARILE 54 >emb|CCT67939.1| related to POX1-acyl-CoA oxidase [Fusarium fujikuroi IMI 58289] Length = 698 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P WVK L+P G GSELLAQERAKS + V +L +LF KE LE KILK Sbjct: 2 PPQNPDWVKALKPSGPQGSELLAQERAKSDINVDQLAEFLFTKEVLERNDKILK 55 >gb|EKJ76068.1| hypothetical protein FPSE_03840 [Fusarium pseudograminearum CS3096] Length = 696 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/54 (55%), Positives = 37/54 (68%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P P WVK L P G GSEL+A+ERA+S + V +L +LF KE LE A+ILK Sbjct: 2 PPPNPDWVKALTPSGPQGSELIAKERAQSDINVDQLATFLFTKEVLERNARILK 55 >gb|EHY56217.1| acyl-CoA oxidase [Exophiala dermatitidis NIH/UT8656] Length = 701 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +2 Query: 185 PAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P WVK L+P G GSELLAQERAKS L V +L N++F +E LE +ILK Sbjct: 5 PDWVKALKPSGPQGSELLAQERAKSTLNVDQLANFMFTRENLERNERILK 54 >gb|EQB50569.1| hypothetical protein CGLO_09961 [Colletotrichum gloeosporioides Cg-14] Length = 699 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 185 PAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKIL 331 P WVKKL+P G G+ELLAQERAKS+L V +L ++F EALE +IL Sbjct: 5 PDWVKKLQPSGPQGTELLAQERAKSKLNVDQLATFMFTNEALERNERIL 53 >gb|EWG53583.1| acyl-CoA oxidase [Fusarium verticillioides 7600] Length = 698 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +2 Query: 173 PTPVPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 P P WVK L+P G GSELLAQERA S + V +L+ +LF KE L+ KILK Sbjct: 2 PPQNPDWVKALKPSGPQGSELLAQERANSDINVDQLSTFLFTKEVLDRNEKILK 55 >gb|ENH84662.1| acyl-oxidase [Colletotrichum orbiculare MAFF 240422] Length = 699 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +2 Query: 185 PAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKIL 331 P WVKKL+P G G+ELLAQERAKS L V +L ++F EALE +IL Sbjct: 5 PDWVKKLQPSGPQGTELLAQERAKSSLNVDQLATFMFTNEALERNERIL 53 >gb|EME44414.1| hypothetical protein DOTSEDRAFT_44640 [Dothistroma septosporum NZE10] Length = 704 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +2 Query: 182 VPAWVKKLEPGGTPGSELLAQERAKSQLPVQELTNYLFGKEALETKAKILK 334 VP WV+ L+P G G+E+L QERA S + V +LT++LFGKEALE K +L+ Sbjct: 7 VPDWVRALKPAGPQGTEILKQERAASNVNVGQLTSFLFGKEALERKRNVLE 57