BLASTX nr result
ID: Akebia25_contig00026567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026567 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826419.1| hypothetical protein AMTR_s00004p00160120 [A... 58 2e-06 >ref|XP_006826419.1| hypothetical protein AMTR_s00004p00160120 [Amborella trichopoda] gi|548830733|gb|ERM93656.1| hypothetical protein AMTR_s00004p00160120 [Amborella trichopoda] Length = 725 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 123 MSDIRKWFMKQHDKNNGNASKPGKPATTDLPPEKSS 16 MSDIRKWFMKQHDK NG +S+P KPATT P K S Sbjct: 1 MSDIRKWFMKQHDKGNGASSQPSKPATTVSQPSKPS 36