BLASTX nr result
ID: Akebia25_contig00026554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026554 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF14611.1| hypothetical protein SEPMUDRAFT_155289 [Sphaeruli... 59 9e-07 gb|EME46556.1| hypothetical protein DOTSEDRAFT_70537 [Dothistrom... 55 8e-06 ref|XP_007289538.1| hypothetical protein MBM_01649 [Marssonina b... 55 8e-06 >gb|EMF14611.1| hypothetical protein SEPMUDRAFT_155289 [Sphaerulina musiva SO2202] Length = 416 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 8/89 (8%) Frame = -3 Query: 243 KTLALPTFVYAVAQNLAVIIPVGVFIAWGTIDDEH--------FDRANMIAISVRVLTCL 88 + + LP+FV+AVAQ +I+P+ V A G + +H D + +I++ ++ L Sbjct: 229 RAILLPSFVFAVAQQATLILPIVVAFALGLPELDHGHVADAAKHDCSKLISMGLKYLAVP 288 Query: 87 ALAGLTSFVLVLPASVALTRIEASLLPAD 1 A +F ++LPA+V LTRIEA LLP D Sbjct: 289 ATGLFVAFAILLPATVTLTRIEALLLPED 317 >gb|EME46556.1| hypothetical protein DOTSEDRAFT_70537 [Dothistroma septosporum NZE10] Length = 422 Score = 55.5 bits (132), Expect = 8e-06 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 9/100 (9%) Frame = -3 Query: 279 WYKRIVRGRYVFKTLALPTFVYAVAQNLAVIIPVGVFIAWG--TIDDEHFDRA------N 124 W + + R K + LP+FV+AVAQ I+PV V G + EH +A + Sbjct: 219 WRRLVPIPRKQVKAILLPSFVFAVAQQATWILPVAVAFMVGLPNVQHEHVIQAAQQKDCH 278 Query: 123 MIAI-SVRVLTCLALAGLTSFVLVLPASVALTRIEASLLP 7 M+ + +R L A +F+++LPASV LTRIEA LLP Sbjct: 279 MLGLLGLRFLAVPATGLFVAFMILLPASVTLTRIEALLLP 318 >ref|XP_007289538.1| hypothetical protein MBM_01649 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406866658|gb|EKD19697.1| hypothetical protein MBM_01649 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 361 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/95 (35%), Positives = 61/95 (64%), Gaps = 5/95 (5%) Frame = -3 Query: 279 WYKRIVRGRYVFKTLALPTFVYAVAQNLAVIIPVGVFIAWGTIDD--EHFDRANMIAISV 106 W++R V + ++K +A+PT V+A+A+ +AV IP+ + + G +D ++ D+ +V Sbjct: 176 WFRR-VPPKSMWKKVAIPTAVFALAEQMAVWIPLYLAVLAGIVDSTPDNVDKMTPHQQTV 234 Query: 105 RVLTCLALAGL---TSFVLVLPASVALTRIEASLL 10 L + +A L F++V+PA+VALTR++ASLL Sbjct: 235 MGLKAIGIAVLGLVLGFLVVIPANVALTRVQASLL 269