BLASTX nr result
ID: Akebia25_contig00026529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026529 (745 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG12562.1| hypothetical protein MPH_10312 [Macrophomina phas... 59 2e-06 >gb|EKG12562.1| hypothetical protein MPH_10312 [Macrophomina phaseolina MS6] Length = 1060 Score = 58.9 bits (141), Expect = 2e-06 Identities = 34/85 (40%), Positives = 40/85 (47%), Gaps = 33/85 (38%) Frame = -2 Query: 159 YEGEKHQHSKLHKDPPAKVQR---------------------------------ELEEKS 79 +E KH ++LHKDPPA R + EK Sbjct: 929 HENGKHDRNRLHKDPPADHVRGHGGEHYGTDGRTGQAGAVSGLQGARAGEPRAVQPGEKE 988 Query: 78 GIVHDSHTGLPMNVGKYGSGAGGTD 4 G+V + HTGLPMNVGKYGSGAGGTD Sbjct: 989 GVVVEPHTGLPMNVGKYGSGAGGTD 1013