BLASTX nr result
ID: Akebia25_contig00026374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026374 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea ... 154 1e-35 gb|ELR03231.1| 40S ribosomal protein S9 [Pseudogymnoascus destru... 153 3e-35 gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 6... 152 4e-35 gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammo... 152 4e-35 gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrio... 152 4e-35 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis ... 152 4e-35 ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [N... 152 4e-35 gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma se... 152 4e-35 gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina ... 152 4e-35 gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis ... 152 4e-35 ref|XP_001546443.1| 40S ribosomal protein S9 [Botryotinia fuckel... 152 4e-35 gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 6... 152 5e-35 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocerc... 151 8e-35 gb|EGX48900.1| hypothetical protein AOL_s00079g121 [Arthrobotrys... 151 1e-34 gb|ESZ90022.1| 40S ribosomal protein S9 [Sclerotinia borealis F-... 149 3e-34 ref|XP_964233.1| 40S ribosomal protein S9 [Neurospora crassa OR7... 149 3e-34 gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS ... 149 4e-34 ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubru... 149 4e-34 ref|XP_003172904.1| 40S ribosomal protein S9 [Arthroderma gypseu... 149 4e-34 ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae C... 149 4e-34 >gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] Length = 195 Score = 154 bits (389), Expect = 1e-35 Identities = 77/78 (98%), Positives = 78/78 (100%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRVLLTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|ELR03231.1| 40S ribosomal protein S9 [Pseudogymnoascus destructans 20631-21] Length = 192 Score = 153 bits (386), Expect = 3e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELK VGEYGLRNKREVWRVLLTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKTVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] Length = 192 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] Length = 193 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218] Length = 191 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|485917877|gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] Length = 191 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10] Length = 193 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6] Length = 191 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] Length = 193 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_001546443.1| 40S ribosomal protein S9 [Botryotinia fuckeliana B05.10] gi|347840177|emb|CCD54749.1| similar to 40S ribosomal protein S9 [Botryotinia fuckeliana T4] gi|472236728|gb|EMR81651.1| putative 40s ribosomal protein s9 protein [Botryotinia fuckeliana BcDW1] Length = 191 Score = 152 bits (385), Expect = 4e-35 Identities = 77/78 (98%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96] Length = 193 Score = 152 bits (384), Expect = 5e-35 Identities = 76/78 (97%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFESARLDSELKI+GEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIIGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis CIRAD86] Length = 193 Score = 151 bits (382), Expect = 8e-35 Identities = 76/78 (97%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKTYKVPRRPFE+ARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EGX48900.1| hypothetical protein AOL_s00079g121 [Arthrobotrys oligospora ATCC 24927] Length = 192 Score = 151 bits (381), Expect = 1e-34 Identities = 75/77 (97%), Positives = 77/77 (100%) Frame = -3 Query: 233 APRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTLD 54 APR+YSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV+LTLSKIRRAARQLLTLD Sbjct: 4 APRTYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVMLTLSKIRRAARQLLTLD 63 Query: 53 EKDPKRLFEGNALIRRL 3 EKDPKRLFEGNALIRRL Sbjct: 64 EKDPKRLFEGNALIRRL 80 >gb|ESZ90022.1| 40S ribosomal protein S9 [Sclerotinia borealis F-4157] Length = 191 Score = 149 bits (377), Expect = 3e-34 Identities = 76/78 (97%), Positives = 76/78 (97%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAP SYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRV LTLSKIRRAARQLLTL Sbjct: 1 MAPVSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_964233.1| 40S ribosomal protein S9 [Neurospora crassa OR74A] gi|28926006|gb|EAA34997.1| 40S ribosomal protein S9 [Neurospora crassa OR74A] gi|88866507|gb|ABD57302.1| unknown [Neurospora crassa] gi|336463565|gb|EGO51805.1| 40S ribosomal protein S9 [Neurospora tetrasperma FGSC 2508] gi|350297215|gb|EGZ78192.1| 40S ribosomal protein S9 [Neurospora tetrasperma FGSC 2509] Length = 190 Score = 149 bits (377), Expect = 3e-34 Identities = 75/78 (96%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPRSYSKT KVPRRPFE+ARLDSELK+VGEYGLRNKREVWRVLLTLSKIRRAARQLLTL Sbjct: 1 MAPRSYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS 112818] gi|326481818|gb|EGE05828.1| ribosomal protein S9 [Trichophyton equinum CBS 127.97] gi|607891804|gb|EZF31376.1| 40S ribosomal protein S9 [Trichophyton interdigitale H6] Length = 191 Score = 149 bits (376), Expect = 4e-34 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAAR+LLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892] gi|326460658|gb|EGD86111.1| ribosomal protein S4 [Trichophyton rubrum CBS 118892] gi|607866634|gb|EZF11976.1| 40S ribosomal protein S9 [Trichophyton rubrum MR850] gi|607901185|gb|EZF38837.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 100081] gi|607913306|gb|EZF49469.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 288.86] gi|607925355|gb|EZF60077.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 289.86] gi|607937165|gb|EZF70598.1| 40S ribosomal protein S9 [Trichophyton soudanense CBS 452.61] gi|607949409|gb|EZF81480.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1448] gi|607961431|gb|EZF92037.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1459] gi|607974141|gb|EZG03407.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 735.88] gi|607985427|gb|EZG13613.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 202.88] Length = 191 Score = 149 bits (376), Expect = 4e-34 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAAR+LLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_003172904.1| 40S ribosomal protein S9 [Arthroderma gypseum CBS 118893] gi|311343290|gb|EFR02493.1| 40S ribosomal protein S9 [Arthroderma gypseum CBS 118893] Length = 191 Score = 149 bits (376), Expect = 4e-34 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAAR+LLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78 >ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480] gi|238845555|gb|EEQ35217.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480] Length = 191 Score = 149 bits (376), Expect = 4e-34 Identities = 74/78 (94%), Positives = 77/78 (98%) Frame = -3 Query: 236 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVLLTLSKIRRAARQLLTL 57 MAPR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAAR+LLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 56 DEKDPKRLFEGNALIRRL 3 DEKDPKRLFEGNALIRRL Sbjct: 61 DEKDPKRLFEGNALIRRL 78