BLASTX nr result
ID: Akebia25_contig00026373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026373 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 6... 165 7e-39 gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammo... 165 7e-39 gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrio... 165 7e-39 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis ... 165 7e-39 ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [N... 165 7e-39 gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma se... 165 7e-39 gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina ... 165 7e-39 gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis ... 165 7e-39 ref|XP_001546443.1| 40S ribosomal protein S9 [Botryotinia fuckel... 165 7e-39 gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 6... 164 9e-39 gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocerc... 164 2e-38 ref|XP_003303583.1| 40S ribosomal protein S9 [Pyrenophora teres ... 163 3e-38 gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS ... 162 5e-38 ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubru... 162 5e-38 ref|XP_003172904.1| 40S ribosomal protein S9 [Arthroderma gypseu... 162 5e-38 ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae C... 162 5e-38 ref|XP_001246606.1| 40S ribosomal protein S9 [Coccidioides immit... 162 5e-38 gb|ESZ90022.1| 40S ribosomal protein S9 [Sclerotinia borealis F-... 162 6e-38 gb|EPS26866.1| hypothetical protein PDE_01806 [Penicillium oxali... 162 6e-38 ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae... 162 6e-38 >gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EXJ61489.1| 40S ribosomal protein S9 [Cladophialophora psammophila CBS 110553] Length = 192 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|ETI28179.1| 40S ribosomal protein S9 [Cladophialophora carrionii CBS 160.54] Length = 193 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218] Length = 191 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_007587858.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] gi|485917877|gb|EOD44674.1| putative 40s ribosomal protein s9 protein [Neofusicoccum parvum UCRNP2] Length = 191 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EME38681.1| ribosomal protein S9-like protein [Dothistroma septosporum NZE10] Length = 193 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EKG11582.1| Ribosomal protein S4/S9 [Macrophomina phaseolina MS6] Length = 191 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EHY54547.1| 40S ribosomal protein S9 [Exophiala dermatitidis NIH/UT8656] Length = 193 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_001546443.1| 40S ribosomal protein S9 [Botryotinia fuckeliana B05.10] gi|347840177|emb|CCD54749.1| similar to 40S ribosomal protein S9 [Botryotinia fuckeliana T4] gi|472236728|gb|EMR81651.1| putative 40s ribosomal protein s9 protein [Botryotinia fuckeliana BcDW1] Length = 191 Score = 165 bits (417), Expect = 7e-39 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EXJ86571.1| 40S ribosomal protein S9 [Capronia epimyces CBS 606.96] Length = 193 Score = 164 bits (416), Expect = 9e-39 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFESARLDSELKI+GEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFESARLDSELKIIGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EME85361.1| hypothetical protein MYCFIDRAFT_60241 [Pseudocercospora fijiensis CIRAD86] Length = 193 Score = 164 bits (414), Expect = 2e-38 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRPFE+ARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPRSYSKTYKVPRRPFEAARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_003303583.1| 40S ribosomal protein S9 [Pyrenophora teres f. teres 0-1] gi|311320337|gb|EFQ88321.1| hypothetical protein PTT_15843 [Pyrenophora teres f. teres 0-1] Length = 270 Score = 163 bits (412), Expect = 3e-38 Identities = 82/96 (85%), Positives = 86/96 (89%) Frame = -2 Query: 289 RTLRHPANRPIMPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSK 110 R L + + PPRSYSKTY VPRRPFESARLD+ELK+VGEYGLRNKREVWRVQLTLSK Sbjct: 68 RQLSSTSTTTMAPPRSYSKTYSVPRRPFESARLDTELKLVGEYGLRNKREVWRVQLTLSK 127 Query: 109 IRRAARELLTLDEKDPKRLFEGNALIRRLVRVGVLD 2 IRRAAR LLTLDEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 128 IRRAARSLLTLDEKDPKRLFEGNALIRRLVRVGVLD 163 >gb|EGD95527.1| ribosomal protein S9 [Trichophyton tonsurans CBS 112818] gi|326481818|gb|EGE05828.1| ribosomal protein S9 [Trichophyton equinum CBS 127.97] gi|607891804|gb|EZF31376.1| 40S ribosomal protein S9 [Trichophyton interdigitale H6] Length = 191 Score = 162 bits (410), Expect = 5e-38 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAARELLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_003237660.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 118892] gi|326460658|gb|EGD86111.1| ribosomal protein S4 [Trichophyton rubrum CBS 118892] gi|607866634|gb|EZF11976.1| 40S ribosomal protein S9 [Trichophyton rubrum MR850] gi|607901185|gb|EZF38837.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 100081] gi|607913306|gb|EZF49469.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 288.86] gi|607925355|gb|EZF60077.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 289.86] gi|607937165|gb|EZF70598.1| 40S ribosomal protein S9 [Trichophyton soudanense CBS 452.61] gi|607949409|gb|EZF81480.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1448] gi|607961431|gb|EZF92037.1| 40S ribosomal protein S9 [Trichophyton rubrum MR1459] gi|607974141|gb|EZG03407.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 735.88] gi|607985427|gb|EZG13613.1| 40S ribosomal protein S9 [Trichophyton rubrum CBS 202.88] Length = 191 Score = 162 bits (410), Expect = 5e-38 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAARELLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_003172904.1| 40S ribosomal protein S9 [Arthroderma gypseum CBS 118893] gi|311343290|gb|EFR02493.1| 40S ribosomal protein S9 [Arthroderma gypseum CBS 118893] Length = 191 Score = 162 bits (410), Expect = 5e-38 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAARELLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_002842953.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480] gi|238845555|gb|EEQ35217.1| 40S ribosomal protein S9 [Arthroderma otae CBS 113480] Length = 191 Score = 162 bits (410), Expect = 5e-38 Identities = 81/85 (95%), Positives = 83/85 (97%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PR+YSKTYKVPRRPFESARLDSELK+VGEYGLRNKREVWRV LTLSKIRRAARELLTL Sbjct: 1 MAPRAYSKTYKVPRRPFESARLDSELKLVGEYGLRNKREVWRVNLTLSKIRRAARELLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >ref|XP_001246606.1| 40S ribosomal protein S9 [Coccidioides immitis RS] gi|303313185|ref|XP_003066604.1| 40S ribosomal protein S9 [Coccidioides posadasii C735 delta SOWgp] gi|240106266|gb|EER24459.1| 40S ribosomal protein S9, putative [Coccidioides posadasii C735 delta SOWgp] gi|320036503|gb|EFW18442.1| 40S ribosomal protein S9 [Coccidioides posadasii str. Silveira] gi|392864161|gb|EAS35030.2| 40S ribosomal protein S9 [Coccidioides immitis RS] Length = 190 Score = 162 bits (410), Expect = 5e-38 Identities = 81/85 (95%), Positives = 84/85 (98%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M PRSYSKTYKVPRRP+ESARLDSELK+VGEYGLRNKREVWRVQLTLSKIRRAARELLTL Sbjct: 1 MAPRSYSKTYKVPRRPYESARLDSELKMVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 +EKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 EEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|ESZ90022.1| 40S ribosomal protein S9 [Sclerotinia borealis F-4157] Length = 191 Score = 162 bits (409), Expect = 6e-38 Identities = 82/85 (96%), Positives = 83/85 (97%) Frame = -2 Query: 256 MPPRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTL 77 M P SYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAAR+LLTL Sbjct: 1 MAPVSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARQLLTL 60 Query: 76 DEKDPKRLFEGNALIRRLVRVGVLD 2 DEKDPKRLFEGNALIRRLVRVGVLD Sbjct: 61 DEKDPKRLFEGNALIRRLVRVGVLD 85 >gb|EPS26866.1| hypothetical protein PDE_01806 [Penicillium oxalicum 114-2] Length = 193 Score = 162 bits (409), Expect = 6e-38 Identities = 81/83 (97%), Positives = 82/83 (98%) Frame = -2 Query: 250 PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE 71 PR YSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE Sbjct: 5 PRVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE 64 Query: 70 KDPKRLFEGNALIRRLVRVGVLD 2 KDPKRLFEGNALIRRLVR+GVLD Sbjct: 65 KDPKRLFEGNALIRRLVRIGVLD 87 >ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae RIB40] gi|238505532|ref|XP_002383988.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357] gi|83773378|dbj|BAE63505.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220690102|gb|EED46452.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357] gi|391863010|gb|EIT72324.1| ribosomal protein [Aspergillus oryzae 3.042] Length = 193 Score = 162 bits (409), Expect = 6e-38 Identities = 81/83 (97%), Positives = 82/83 (98%) Frame = -2 Query: 250 PRSYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE 71 PR YSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE Sbjct: 5 PRVYSKTYKVPRRPFESARLDSELKIVGEYGLRNKREVWRVQLTLSKIRRAARELLTLDE 64 Query: 70 KDPKRLFEGNALIRRLVRVGVLD 2 KDPKRLFEGNALIRRLVR+GVLD Sbjct: 65 KDPKRLFEGNALIRRLVRIGVLD 87