BLASTX nr result
ID: Akebia25_contig00026292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026292 (1558 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002536728.1| conserved hypothetical protein [Ricinus comm... 59 5e-06 >ref|XP_002536728.1| conserved hypothetical protein [Ricinus communis] gi|223518744|gb|EEF25655.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 59.3 bits (142), Expect = 5e-06 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = -1 Query: 1138 PQALKIPMNLGLQC--YCNGYRHLLRIQQSAYQELRKLPSTNCFGSSSQSPC 989 P L+ MNLGL Y NG+RHLLRI+ SAY+ELRKLPST SSSQSPC Sbjct: 3 PGLLRFLMNLGLDFGGYRNGHRHLLRIRHSAYRELRKLPST---WSSSQSPC 51