BLASTX nr result
ID: Akebia25_contig00026098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026098 (575 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [A... 62 1e-07 gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Mor... 61 2e-07 ref|XP_007218417.1| hypothetical protein PRUPE_ppa011530mg [Prun... 61 2e-07 gb|EYU31935.1| hypothetical protein MIMGU_mgv1a013200mg [Mimulus... 60 3e-07 ref|XP_006375261.1| hypothetical protein POPTR_0014s05740g [Popu... 60 5e-07 ref|XP_004306967.1| PREDICTED: probable plastid-lipid-associated... 60 5e-07 ref|XP_006359587.1| PREDICTED: probable plastid-lipid-associated... 59 9e-07 ref|XP_004248552.1| PREDICTED: probable plastid-lipid-associated... 59 9e-07 ref|XP_007052201.1| Plastid-lipid associated protein PAP / fibri... 58 2e-06 ref|XP_002511641.1| structural molecule, putative [Ricinus commu... 58 2e-06 ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated... 58 2e-06 ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citr... 58 2e-06 ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated... 58 2e-06 ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated... 57 3e-06 ref|XP_001784533.1| predicted protein [Physcomitrella patens] gi... 56 6e-06 >ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] gi|548840652|gb|ERN00763.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] Length = 226 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FES+YLDD+IRVVKDIR DYLVVD APY+WKE Sbjct: 195 FESIYLDDDIRVVKDIRGDYLVVDRAPYNWKE 226 >gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Morus notabilis] Length = 211 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 F++VYLDDEIRVVKDIR DYLVVD APY+WKE Sbjct: 180 FDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 211 >ref|XP_007218417.1| hypothetical protein PRUPE_ppa011530mg [Prunus persica] gi|462414879|gb|EMJ19616.1| hypothetical protein PRUPE_ppa011530mg [Prunus persica] Length = 207 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 F++VYLDDEIRVVKDIR DYLVVD APY+WKE Sbjct: 176 FDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 207 >gb|EYU31935.1| hypothetical protein MIMGU_mgv1a013200mg [Mimulus guttatus] Length = 228 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FES+Y+DDEIRVVKDIR DYL+V+ APYSWKE Sbjct: 197 FESLYIDDEIRVVKDIRQDYLIVERAPYSWKE 228 >ref|XP_006375261.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|566202787|ref|XP_006375262.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|566202789|ref|XP_006375263.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323580|gb|ERP53058.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323581|gb|ERP53059.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] gi|550323582|gb|ERP53060.1| hypothetical protein POPTR_0014s05740g [Populus trichocarpa] Length = 211 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FES+Y+D+EIRVVKDIR DYLVVD APY+WKE Sbjct: 180 FESLYIDEEIRVVKDIRGDYLVVDKAPYAWKE 211 >ref|XP_004306967.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 211 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDDEIRVVKDIR DYLVVD APY+W E Sbjct: 180 FETVYLDDEIRVVKDIREDYLVVDRAPYAWTE 211 >ref|XP_006359587.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X1 [Solanum tuberosum] gi|565387610|ref|XP_006359588.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X2 [Solanum tuberosum] gi|565387612|ref|XP_006359589.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X3 [Solanum tuberosum] gi|565387614|ref|XP_006359590.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X4 [Solanum tuberosum] gi|565387616|ref|XP_006359591.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X5 [Solanum tuberosum] Length = 206 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDD+IRVVKDIR DYL+V+ APY+WKE Sbjct: 175 FETVYLDDDIRVVKDIRQDYLIVERAPYTWKE 206 >ref|XP_004248552.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Solanum lycopersicum] Length = 206 Score = 58.9 bits (141), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDD+IRVVKDIR DYL+V+ APY+WKE Sbjct: 175 FETVYLDDDIRVVKDIRQDYLIVERAPYTWKE 206 >ref|XP_007052201.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|590723502|ref|XP_007052202.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|508704462|gb|EOX96358.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|508704463|gb|EOX96359.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] Length = 211 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDD+ RVVKDIR+DYLVV+ APY+WKE Sbjct: 180 FETVYLDDDFRVVKDIRDDYLVVERAPYNWKE 211 >ref|XP_002511641.1| structural molecule, putative [Ricinus communis] gi|223548821|gb|EEF50310.1| structural molecule, putative [Ricinus communis] Length = 217 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FESVY+DD+IRV KDIR DYLVVD APY+W+E Sbjct: 186 FESVYVDDDIRVAKDIRGDYLVVDRAPYAWRE 217 >ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X1 [Citrus sinensis] Length = 222 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDDEIRVVKDIR DYLVV+ APY W E Sbjct: 191 FETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 222 >ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905704|ref|XP_006445340.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905706|ref|XP_006445341.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905708|ref|XP_006445342.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547601|gb|ESR58579.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547602|gb|ESR58580.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547603|gb|ESR58581.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547604|gb|ESR58582.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] Length = 140 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 FE+VYLDDEIRVVKDIR DYLVV+ APY W E Sbjct: 109 FETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 140 >ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cucumis sativus] Length = 213 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 F++VYLDDEIRVVKDIR DYL+V+ APYSW E Sbjct: 182 FDTVYLDDEIRVVKDIRGDYLIVERAPYSWTE 213 >ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cicer arietinum] Length = 214 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSWKE 5 F++VYLDD++RVVKDIR DYLVVD A YSWKE Sbjct: 183 FDTVYLDDDLRVVKDIRGDYLVVDRASYSWKE 214 >ref|XP_001784533.1| predicted protein [Physcomitrella patens] gi|162663914|gb|EDQ50654.1| predicted protein [Physcomitrella patens] Length = 218 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 100 FESVYLDDEIRVVKDIRNDYLVVDCAPYSW 11 FES+YLDD+IRV KDIR DYLVVD APY+W Sbjct: 185 FESIYLDDDIRVAKDIRGDYLVVDRAPYTW 214