BLASTX nr result
ID: Akebia25_contig00026080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00026080 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC98137.1| hypothetical protein BAUCODRAFT_32134 [Baudoinia ... 72 8e-11 ref|XP_002841453.1| 60S ribosomal protein L21 [Tuber melanosporu... 71 2e-10 emb|CCX15851.1| Similar to 60S ribosomal protein L21-B; acc. no.... 69 5e-10 gb|EME38680.1| hypothetical protein DOTSEDRAFT_75434 [Dothistrom... 69 7e-10 gb|EMF08138.1| 60S ribosomal protein L21-A [Sphaerulina musiva S... 68 1e-09 ref|XP_002152418.1| 60S ribosomal protein L21 [Talaromyces marne... 66 6e-09 ref|XP_457176.1| 60S ribosomal protein L21 [Debaryomyces hanseni... 66 6e-09 ref|XP_001246607.1| 60S ribosomal protein L21 [Coccidioides immi... 65 7e-09 ref|XP_002794234.1| 60S ribosomal protein L21 [Paracoccidioides ... 65 1e-08 ref|XP_002486004.1| 60S ribosomal protein L21 [Talaromyces stipi... 65 1e-08 gb|EME85362.1| hypothetical protein MYCFIDRAFT_88767 [Pseudocerc... 65 1e-08 ref|XP_001483408.1| conserved hypothetical protein [Meyerozyma g... 64 2e-08 ref|XP_001484310.1| conserved hypothetical protein [Meyerozyma g... 64 2e-08 emb|CDM31878.1| Ribosomal protein L21e [Penicillium roqueforti] 64 2e-08 ref|XP_004204484.1| Piso0_000335 [Millerozyma farinosa CBS 7064]... 64 2e-08 gb|EZF11974.1| hypothetical protein H100_07057 [Trichophyton rub... 64 3e-08 gb|EGE05827.1| 60S ribosomal protein [Trichophyton equinum CBS 1... 64 3e-08 ref|XP_003237659.1| 60S ribosomal protein L21 [Trichophyton rubr... 64 3e-08 ref|XP_003025613.1| hypothetical protein TRV_00253 [Trichophyton... 64 3e-08 ref|XP_003014787.1| hypothetical protein ARB_07348 [Arthroderma ... 64 3e-08 >gb|EMC98137.1| hypothetical protein BAUCODRAFT_32134 [Baudoinia compniacensis UAMH 10762] Length = 160 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AKKR+AKE+G+H+ LKRQ V PREARTV+ DNKPESIVP+ YET I Sbjct: 114 AKKRKAKEEGTHMHLKRQPVVPREARTVSTKDNKPESIVPIAYETTI 160 >ref|XP_002841453.1| 60S ribosomal protein L21 [Tuber melanosporum Mel28] gi|295637693|emb|CAZ85644.1| unnamed protein product [Tuber melanosporum] Length = 137 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AK++QAKEDG+HV LKRQ V+PRE+RTV+ DN PE++ P+PYET I Sbjct: 91 AKQKQAKEDGTHVHLKRQPVQPRESRTVSTQDNLPETVTPIPYETTI 137 >emb|CCX15851.1| Similar to 60S ribosomal protein L21-B; acc. no. Q12672 [Pyronema omphalodes CBS 100304] Length = 160 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AK+ QAK DG HV LKR+AVKPREARTV A+DN PE++VP+ YET I Sbjct: 114 AKRIQAKTDGVHVHLKREAVKPREARTVAAADNLPETVVPIAYETTI 160 >gb|EME38680.1| hypothetical protein DOTSEDRAFT_75434 [Dothistroma septosporum NZE10] Length = 137 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AK+R+AKE G HV LKRQ V PREARTV+ DNKPESI P+ YET I Sbjct: 91 AKQRKAKETGEHVHLKRQPVMPREARTVSTKDNKPESITPIAYETTI 137 >gb|EMF08138.1| 60S ribosomal protein L21-A [Sphaerulina musiva SO2202] Length = 160 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AK+R AKE G HV LKRQ +PREARTV+A DNKPE++ P+ YET I Sbjct: 114 AKQRHAKETGEHVHLKRQPAQPREARTVSAKDNKPENVTPIAYETTI 160 >ref|XP_002152418.1| 60S ribosomal protein L21 [Talaromyces marneffei ATCC 18224] gi|210065387|gb|EEA19481.1| 60S ribosomal protein L21, putative [Talaromyces marneffei ATCC 18224] Length = 160 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKRQAKE G H+ LKRQAV+PR+A V +SDN PE+I P+PY+T I Sbjct: 115 KKRQAKEQGVHLHLKRQAVQPRDAHVVESSDNFPETITPIPYDTHI 160 >ref|XP_457176.1| 60S ribosomal protein L21 [Debaryomyces hansenii CBS767] gi|294655832|ref|XP_458024.2| 60S ribosomal protein L21 [Debaryomyces hansenii CBS767] gi|49652841|emb|CAG85171.1| DEHA2B04928p [Debaryomyces hansenii CBS767] gi|199430640|emb|CAG86087.2| DEHA2C07920p [Debaryomyces hansenii CBS767] Length = 160 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 A KR+AK +G HV LKRQ VKPR+AR VT +N P+++ P+PYETFI Sbjct: 114 ALKREAKANGEHVHLKRQPVKPRDARVVTTKENVPQTLAPVPYETFI 160 >ref|XP_001246607.1| 60S ribosomal protein L21 [Coccidioides immitis RS] gi|303313183|ref|XP_003066603.1| 60S ribosomal protein L21 [Coccidioides posadasii C735 delta SOWgp] gi|240106265|gb|EER24458.1| 60S ribosomal protein L21-B, putative [Coccidioides posadasii C735 delta SOWgp] gi|320036504|gb|EFW18443.1| 60S ribosomal protein L21 [Coccidioides posadasii str. Silveira] gi|392864160|gb|EAS35031.2| ribosomal protein rpl21 [Coccidioides immitis RS] Length = 160 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PR+ARTV+ +N PE+I+P+PYET I Sbjct: 115 KKRKAKEEGIHVHLKRQPVVPRDARTVSTENNFPETIIPVPYETTI 160 >ref|XP_002794234.1| 60S ribosomal protein L21 [Paracoccidioides sp. 'lutzii' Pb01] gi|225680016|gb|EEH18300.1| 60S ribosomal protein L21 [Paracoccidioides brasiliensis Pb03] gi|226286340|gb|EEH41906.1| 60S ribosomal protein L21-A [Paracoccidioides sp. 'lutzii' Pb01] gi|226291799|gb|EEH47227.1| 60S ribosomal protein L21-A [Paracoccidioides brasiliensis Pb18] Length = 160 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREARTV+ N PE+I P+PYET I Sbjct: 115 KKRKAKEEGIHVHLKRQPVGPREARTVSTEGNLPETITPVPYETTI 160 >ref|XP_002486004.1| 60S ribosomal protein L21 [Talaromyces stipitatus ATCC 10500] gi|218714343|gb|EED13766.1| 60S ribosomal protein L21, putative [Talaromyces stipitatus ATCC 10500] Length = 160 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKRQAKE G H+ LKRQAV+PR A V +SDN PE+I P+PY+T I Sbjct: 115 KKRQAKEQGIHLHLKRQAVQPRSAHVVDSSDNFPETITPIPYDTHI 160 >gb|EME85362.1| hypothetical protein MYCFIDRAFT_88767 [Pseudocercospora fijiensis CIRAD86] Length = 160 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AKK+QAKE G V+LKRQA PR+A TV+ DNKPE++ P+ YET I Sbjct: 114 AKKKQAKETGERVYLKRQAAVPRDAHTVSGKDNKPENVAPIAYETTI 160 >ref|XP_001483408.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 6260] gi|146391881|gb|EDK40039.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 6260] Length = 160 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AKKR+AK G VFLKRQ KPREAR V DN P+++ P+PYETFI Sbjct: 114 AKKREAKAKGETVFLKRQPAKPREARIVKTVDNVPQTLAPVPYETFI 160 >ref|XP_001484310.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 6260] gi|146391435|gb|EDK39593.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 6260] Length = 130 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 AKKR+AK G VFLKRQ KPREAR V DN P+++ P+PYETFI Sbjct: 84 AKKREAKAKGETVFLKRQPAKPREARIVKTVDNVPQTLAPVPYETFI 130 >emb|CDM31878.1| Ribosomal protein L21e [Penicillium roqueforti] Length = 160 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE G HV LKRQAV PREA V +DNKPE++VP+ Y+T I Sbjct: 115 KKREAKEKGVHVHLKRQAVGPREAHFVKQADNKPETVVPIAYDTHI 160 >ref|XP_004204484.1| Piso0_000335 [Millerozyma farinosa CBS 7064] gi|448124897|ref|XP_004205042.1| Piso0_000335 [Millerozyma farinosa CBS 7064] gi|358249675|emb|CCE72741.1| Piso0_000335 [Millerozyma farinosa CBS 7064] gi|358350023|emb|CCE73302.1| Piso0_000335 [Millerozyma farinosa CBS 7064] Length = 160 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 3 AKKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 A KR+AK G HVFLKRQ KPR+++ VT N PE++ P+PYETFI Sbjct: 114 ALKREAKAKGEHVFLKRQPAKPRDSKVVTTESNIPETLAPVPYETFI 160 >gb|EZF11974.1| hypothetical protein H100_07057 [Trichophyton rubrum MR850] gi|607891805|gb|EZF31377.1| hypothetical protein H101_05012 [Trichophyton interdigitale H6] gi|607901183|gb|EZF38835.1| hypothetical protein H102_07020 [Trichophyton rubrum CBS 100081] gi|607913304|gb|EZF49467.1| hypothetical protein H103_07042 [Trichophyton rubrum CBS 288.86] gi|607925353|gb|EZF60075.1| hypothetical protein H104_06997 [Trichophyton rubrum CBS 289.86] gi|607937163|gb|EZF70596.1| hypothetical protein H105_07054 [Trichophyton soudanense CBS 452.61] gi|607949407|gb|EZF81478.1| hypothetical protein H110_07038 [Trichophyton rubrum MR1448] gi|607961429|gb|EZF92035.1| hypothetical protein H113_07092 [Trichophyton rubrum MR1459] gi|607974139|gb|EZG03405.1| hypothetical protein H106_06883 [Trichophyton rubrum CBS 735.88] gi|607985425|gb|EZG13611.1| hypothetical protein H107_07201 [Trichophyton rubrum CBS 202.88] Length = 160 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREAR V+ N PE++ PLPYET I Sbjct: 115 KKRKAKEEGVHVHLKRQPVGPREARVVSLEGNAPETLAPLPYETTI 160 >gb|EGE05827.1| 60S ribosomal protein [Trichophyton equinum CBS 127.97] Length = 152 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREAR V+ N PE++ PLPYET I Sbjct: 107 KKRKAKEEGVHVHLKRQPVGPREARVVSLEGNAPETLAPLPYETTI 152 >ref|XP_003237659.1| 60S ribosomal protein L21 [Trichophyton rubrum CBS 118892] gi|326460657|gb|EGD86110.1| 60S ribosomal protein [Trichophyton rubrum CBS 118892] gi|326471517|gb|EGD95526.1| 60S ribosomal protein [Trichophyton tonsurans CBS 112818] gi|607866633|gb|EZF11975.1| hypothetical protein H100_07057 [Trichophyton rubrum MR850] gi|607901184|gb|EZF38836.1| hypothetical protein H102_07020 [Trichophyton rubrum CBS 100081] gi|607913305|gb|EZF49468.1| hypothetical protein H103_07042 [Trichophyton rubrum CBS 288.86] gi|607925354|gb|EZF60076.1| hypothetical protein H104_06997 [Trichophyton rubrum CBS 289.86] gi|607937164|gb|EZF70597.1| hypothetical protein H105_07054 [Trichophyton soudanense CBS 452.61] gi|607949408|gb|EZF81479.1| hypothetical protein H110_07038 [Trichophyton rubrum MR1448] gi|607961430|gb|EZF92036.1| hypothetical protein H113_07092 [Trichophyton rubrum MR1459] gi|607974140|gb|EZG03406.1| hypothetical protein H106_06883 [Trichophyton rubrum CBS 735.88] gi|607985426|gb|EZG13612.1| hypothetical protein H107_07201 [Trichophyton rubrum CBS 202.88] Length = 133 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREAR V+ N PE++ PLPYET I Sbjct: 88 KKRKAKEEGVHVHLKRQPVGPREARVVSLEGNAPETLAPLPYETTI 133 >ref|XP_003025613.1| hypothetical protein TRV_00253 [Trichophyton verrucosum HKI 0517] gi|291189728|gb|EFE45002.1| hypothetical protein TRV_00253 [Trichophyton verrucosum HKI 0517] Length = 133 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREAR V+ N PE++ PLPYET I Sbjct: 88 KKRKAKEEGVHVHLKRQPVGPREARVVSLEGNAPETLAPLPYETTI 133 >ref|XP_003014787.1| hypothetical protein ARB_07348 [Arthroderma benhamiae CBS 112371] gi|291178093|gb|EFE33884.1| hypothetical protein ARB_07348 [Arthroderma benhamiae CBS 112371] Length = 133 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 6 KKRQAKEDGSHVFLKRQAVKPREARTVTASDNKPESIVPLPYETFI 143 KKR+AKE+G HV LKRQ V PREAR V+ N PE++ PLPYET I Sbjct: 88 KKRKAKEEGVHVHLKRQPVGPREARVVSLEGNAPETLAPLPYETTI 133