BLASTX nr result
ID: Akebia25_contig00024734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024734 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154416.1| hypothetical protein PHAVU_003G117800g [Phas... 62 6e-08 ref|XP_006841645.1| hypothetical protein AMTR_s00003p00237740 [A... 62 6e-08 ref|XP_007035865.1| O-acetyltransferase family protein isoform 2... 62 6e-08 ref|XP_007035864.1| O-acetyltransferase family protein isoform 1... 62 6e-08 ref|XP_004508117.1| PREDICTED: CAS1 domain-containing protein 1-... 62 6e-08 ref|XP_004508116.1| PREDICTED: CAS1 domain-containing protein 1-... 62 6e-08 ref|XP_006600388.1| PREDICTED: CAS1 domain-containing protein 1-... 62 8e-08 ref|XP_002312313.2| hypothetical protein POPTR_0008s10190g [Popu... 62 8e-08 ref|XP_003550779.1| PREDICTED: CAS1 domain-containing protein 1-... 62 8e-08 ref|XP_006378551.1| hypothetical protein POPTR_0010s15840g [Popu... 62 1e-07 ref|XP_002314967.2| hypothetical protein POPTR_0010s15840g [Popu... 62 1e-07 ref|XP_006407932.1| hypothetical protein EUTSA_v10020460mg [Eutr... 61 1e-07 ref|XP_006407931.1| hypothetical protein EUTSA_v10020460mg [Eutr... 61 1e-07 ref|XP_006296697.1| hypothetical protein CARUB_v10013396mg [Caps... 61 1e-07 ref|XP_006583994.1| PREDICTED: CAS1 domain-containing protein 1-... 61 2e-07 ref|XP_006583993.1| PREDICTED: CAS1 domain-containing protein 1-... 61 2e-07 ref|XP_006841124.1| hypothetical protein AMTR_s00086p00106020 [A... 61 2e-07 ref|XP_004155531.1| PREDICTED: LOW QUALITY PROTEIN: CAS1 domain-... 61 2e-07 ref|XP_004134577.1| PREDICTED: CAS1 domain-containing protein 1-... 61 2e-07 ref|NP_001118592.1| O-acetyltransferase family protein [Arabidop... 61 2e-07 >ref|XP_007154416.1| hypothetical protein PHAVU_003G117800g [Phaseolus vulgaris] gi|561027770|gb|ESW26410.1| hypothetical protein PHAVU_003G117800g [Phaseolus vulgaris] Length = 546 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 459 LRSGVPDGQPKLLLSLIPDYPMLNFMLTTSIYV 491 >ref|XP_006841645.1| hypothetical protein AMTR_s00003p00237740 [Amborella trichopoda] gi|548843666|gb|ERN03320.1| hypothetical protein AMTR_s00003p00237740 [Amborella trichopoda] Length = 543 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYVV 205 +RSG+PDGQPKWLLSLI +YP+LNFMLTT+IYV+ Sbjct: 456 LRSGMPDGQPKWLLSLIPNYPLLNFMLTTAIYVL 489 >ref|XP_007035865.1| O-acetyltransferase family protein isoform 2 [Theobroma cacao] gi|508714894|gb|EOY06791.1| O-acetyltransferase family protein isoform 2 [Theobroma cacao] Length = 544 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 457 LRSGVPDGQPKLLLSLIPDYPMLNFMLTTSIYV 489 >ref|XP_007035864.1| O-acetyltransferase family protein isoform 1 [Theobroma cacao] gi|508714893|gb|EOY06790.1| O-acetyltransferase family protein isoform 1 [Theobroma cacao] Length = 545 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 458 LRSGVPDGQPKLLLSLIPDYPMLNFMLTTSIYV 490 >ref|XP_004508117.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Cicer arietinum] Length = 556 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 461 LRSGVPDGQPKLLLSLIPDYPMLNFMLTTSIYV 493 >ref|XP_004508116.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Cicer arietinum] Length = 557 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 462 LRSGVPDGQPKLLLSLIPDYPMLNFMLTTSIYV 494 >ref|XP_006600388.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Glycine max] Length = 546 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSG+PDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 459 LRSGIPDGQPKLLLSLIPDYPMLNFMLTTSIYV 491 >ref|XP_002312313.2| hypothetical protein POPTR_0008s10190g [Populus trichocarpa] gi|550332773|gb|EEE89680.2| hypothetical protein POPTR_0008s10190g [Populus trichocarpa] Length = 567 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSG+PDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 483 LRSGIPDGQPKLLLSLIPDYPMLNFMLTTSIYV 515 >ref|XP_003550779.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Glycine max] Length = 545 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSG+PDGQPK LLSLI DYPMLNFMLTTSIYV Sbjct: 458 LRSGIPDGQPKLLLSLIPDYPMLNFMLTTSIYV 490 >ref|XP_006378551.1| hypothetical protein POPTR_0010s15840g [Populus trichocarpa] gi|550329898|gb|ERP56348.1| hypothetical protein POPTR_0010s15840g [Populus trichocarpa] Length = 546 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSG+PDGQPK LLSLI DYPMLNFMLTTSIY+ Sbjct: 459 LRSGIPDGQPKLLLSLIPDYPMLNFMLTTSIYI 491 >ref|XP_002314967.2| hypothetical protein POPTR_0010s15840g [Populus trichocarpa] gi|550329897|gb|EEF01138.2| hypothetical protein POPTR_0010s15840g [Populus trichocarpa] Length = 545 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSG+PDGQPK LLSLI DYPMLNFMLTTSIY+ Sbjct: 458 LRSGIPDGQPKLLLSLIPDYPMLNFMLTTSIYI 490 >ref|XP_006407932.1| hypothetical protein EUTSA_v10020460mg [Eutrema salsugineum] gi|557109078|gb|ESQ49385.1| hypothetical protein EUTSA_v10020460mg [Eutrema salsugineum] Length = 545 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYP+LNFMLTTSIYV Sbjct: 458 LRSGVPDGQPKLLLSLIPDYPLLNFMLTTSIYV 490 >ref|XP_006407931.1| hypothetical protein EUTSA_v10020460mg [Eutrema salsugineum] gi|557109077|gb|ESQ49384.1| hypothetical protein EUTSA_v10020460mg [Eutrema salsugineum] Length = 544 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYP+LNFMLTTSIYV Sbjct: 457 LRSGVPDGQPKLLLSLIPDYPLLNFMLTTSIYV 489 >ref|XP_006296697.1| hypothetical protein CARUB_v10013396mg [Capsella rubella] gi|482565406|gb|EOA29595.1| hypothetical protein CARUB_v10013396mg [Capsella rubella] Length = 545 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI DYP+LNFMLTTSIYV Sbjct: 458 LRSGVPDGQPKLLLSLIPDYPLLNFMLTTSIYV 490 >ref|XP_006583994.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X2 [Glycine max] Length = 551 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI D+PMLNFMLTTSIYV Sbjct: 458 LRSGVPDGQPKLLLSLIPDFPMLNFMLTTSIYV 490 >ref|XP_006583993.1| PREDICTED: CAS1 domain-containing protein 1-like isoform X1 [Glycine max] Length = 552 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSLI D+PMLNFMLTTSIYV Sbjct: 459 LRSGVPDGQPKLLLSLIPDFPMLNFMLTTSIYV 491 >ref|XP_006841124.1| hypothetical protein AMTR_s00086p00106020 [Amborella trichopoda] gi|548843018|gb|ERN02799.1| hypothetical protein AMTR_s00086p00106020 [Amborella trichopoda] Length = 380 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYVV 205 +RSG+P+GQPKWLLS I DYP+LNFMLTT+IYV+ Sbjct: 275 LRSGMPNGQPKWLLSFIPDYPLLNFMLTTAIYVL 308 >ref|XP_004155531.1| PREDICTED: LOW QUALITY PROTEIN: CAS1 domain-containing protein 1-like [Cucumis sativus] Length = 542 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYVV 205 +RS VP+GQPKWLLS+I +YPMLNFMLTT+IYV+ Sbjct: 458 LRSNVPNGQPKWLLSIIPEYPMLNFMLTTAIYVI 491 >ref|XP_004134577.1| PREDICTED: CAS1 domain-containing protein 1-like [Cucumis sativus] Length = 542 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYVV 205 +RS VP+GQPKWLLS+I +YPMLNFMLTT+IYV+ Sbjct: 458 LRSNVPNGQPKWLLSIIPEYPMLNFMLTTAIYVI 491 >ref|NP_001118592.1| O-acetyltransferase family protein [Arabidopsis thaliana] gi|51970928|dbj|BAD44156.1| unknown protein [Arabidopsis thaliana] gi|332640893|gb|AEE74414.1| O-acetyltransferase family protein [Arabidopsis thaliana] Length = 544 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 104 VRSGVPDGQPKWLLSLILDYPMLNFMLTTSIYV 202 +RSGVPDGQPK LLSL+ DYP+LNFMLTTSIYV Sbjct: 457 LRSGVPDGQPKLLLSLVPDYPLLNFMLTTSIYV 489