BLASTX nr result
ID: Akebia25_contig00024586
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024586 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855540.1| hypothetical protein AMTR_s00057p00215390 [A... 97 2e-18 ref|XP_007206079.1| hypothetical protein PRUPE_ppa012864mg [Prun... 97 2e-18 ref|XP_004302400.1| PREDICTED: probable histone H2A.5-like [Frag... 96 7e-18 ref|XP_006433398.1| hypothetical protein CICLE_v10002795mg [Citr... 94 2e-17 ref|XP_002318994.2| hypothetical protein POPTR_0013s01890g [Popu... 93 3e-17 ref|XP_006344647.1| PREDICTED: histone H2A.1-like [Solanum tuber... 92 6e-17 ref|XP_004230227.1| PREDICTED: histone H2A.1-like [Solanum lycop... 92 6e-17 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 92 6e-17 ref|XP_002283971.1| PREDICTED: probable histone H2A.5 [Vitis vin... 92 1e-16 gb|AEC10950.1| histone H2A [Camellia sinensis] 91 1e-16 ref|XP_003626258.1| Histone H2A [Medicago truncatula] gi|1243600... 91 1e-16 ref|XP_006848587.1| hypothetical protein AMTR_s00168p00048800 [A... 90 3e-16 ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|... 90 3e-16 gb|ABK26850.1| unknown [Picea sitchensis] 90 4e-16 gb|ABK23043.1| unknown [Picea sitchensis] 90 4e-16 ref|XP_006382493.1| hypothetical protein POPTR_0005s02660g [Popu... 89 6e-16 ref|XP_002274570.1| PREDICTED: probable histone H2A.4 isoform 1 ... 89 6e-16 ref|XP_007016497.1| Histone H2A 12 isoform 1 [Theobroma cacao] g... 89 8e-16 dbj|BAC53941.1| H2A histone [Nicotiana tabacum] 89 8e-16 gb|AFK44015.1| unknown [Lotus japonicus] 89 8e-16 >ref|XP_006855540.1| hypothetical protein AMTR_s00057p00215390 [Amborella trichopoda] gi|548859306|gb|ERN17007.1| hypothetical protein AMTR_s00057p00215390 [Amborella trichopoda] Length = 147 Score = 97.4 bits (241), Expect = 2e-18 Identities = 49/76 (64%), Positives = 54/76 (71%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 ME+GK K GGRKG K+K VSKS KAGLQFPVGRIARFLKKGRYAQR+GTGAP+Y+ Sbjct: 1 MESGKAAKSVGGRKGGVKKKSVSKSVKAGLQFPVGRIARFLKKGRYAQRVGTGAPVYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_007206079.1| hypothetical protein PRUPE_ppa012864mg [Prunus persica] gi|462401721|gb|EMJ07278.1| hypothetical protein PRUPE_ppa012864mg [Prunus persica] Length = 151 Score = 97.4 bits (241), Expect = 2e-18 Identities = 51/76 (67%), Positives = 54/76 (71%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 MEA K TK AGGRKG ++K VSKS KAGLQFPVGRIARFLKKGRYAQR GTGAPIY+ Sbjct: 1 MEAAKVTKGAGGRKGGERKKSVSKSVKAGLQFPVGRIARFLKKGRYAQRTGTGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_004302400.1| PREDICTED: probable histone H2A.5-like [Fragaria vesca subsp. vesca] Length = 148 Score = 95.5 bits (236), Expect = 7e-18 Identities = 49/76 (64%), Positives = 55/76 (72%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 ME+GK T+ AGGRKG ++K VSKS KAGLQFPVGRIARFLKKGRYAQR G+GAPIY+ Sbjct: 1 MESGKVTRGAGGRKGGDRKKSVSKSVKAGLQFPVGRIARFLKKGRYAQRTGSGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_006433398.1| hypothetical protein CICLE_v10002795mg [Citrus clementina] gi|568836075|ref|XP_006472074.1| PREDICTED: probable histone H2A.5-like [Citrus sinensis] gi|557535520|gb|ESR46638.1| hypothetical protein CICLE_v10002795mg [Citrus clementina] Length = 143 Score = 94.0 bits (232), Expect = 2e-17 Identities = 49/76 (64%), Positives = 53/76 (69%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 ME K TK AGGR+G RK +SKS KAGLQFPVGRIARFLKKGRYAQR+G+GAPIYM Sbjct: 1 MEVTKPTKGAGGRRGGGGRKKISKSVKAGLQFPVGRIARFLKKGRYAQRMGSGAPIYMAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_002318994.2| hypothetical protein POPTR_0013s01890g [Populus trichocarpa] gi|550324724|gb|EEE94917.2| hypothetical protein POPTR_0013s01890g [Populus trichocarpa] Length = 145 Score = 93.2 bits (230), Expect = 3e-17 Identities = 48/72 (66%), Positives = 53/72 (73%) Frame = -3 Query: 217 KTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXXXX 38 K TK AGGR+G ++K VSKSTKAGLQFPVGRIARFLKKGRYAQR+G+GAPIYM Sbjct: 6 KATKGAGGRRGGERKKSVSKSTKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYMAAVLEY 65 Query: 37 XXXXXXXXAGNA 2 AGNA Sbjct: 66 LAAEVLELAGNA 77 >ref|XP_006344647.1| PREDICTED: histone H2A.1-like [Solanum tuberosum] Length = 146 Score = 92.4 bits (228), Expect = 6e-17 Identities = 47/76 (61%), Positives = 55/76 (72%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 M+A KTTK AGGRKG ++K V+KS KAGLQFPVGRI R+LKKGRYAQR+G+GAPIY+ Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_004230227.1| PREDICTED: histone H2A.1-like [Solanum lycopersicum] gi|122003|sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 92.4 bits (228), Expect = 6e-17 Identities = 47/76 (61%), Positives = 55/76 (72%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 M+A KTTK AGGRKG ++K V+KS KAGLQFPVGRI R+LKKGRYAQR+G+GAPIY+ Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 92.4 bits (228), Expect = 6e-17 Identities = 47/76 (61%), Positives = 55/76 (72%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 M+A KTTK AGGRKG ++K V+KS KAGLQFPVGRI R+LKKGRYAQR+G+GAPIY+ Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >ref|XP_002283971.1| PREDICTED: probable histone H2A.5 [Vitis vinifera] gi|147820539|emb|CAN67660.1| hypothetical protein VITISV_044408 [Vitis vinifera] gi|296089682|emb|CBI39501.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 91.7 bits (226), Expect = 1e-16 Identities = 49/76 (64%), Positives = 52/76 (68%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 ME K TK AGGRKG ++K VSKS KAGLQFPVGRIARFLK GRYAQR GTGAPIY+ Sbjct: 1 MENTKPTKGAGGRKGGERKKSVSKSVKAGLQFPVGRIARFLKTGRYAQRTGTGAPIYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >gb|AEC10950.1| histone H2A [Camellia sinensis] Length = 151 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/75 (64%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = -3 Query: 223 AGKTTKPAGGRKGSA-KRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXX 47 AGK K AGGRKG K+KPVS+S KAGLQFPVGRI R+LKKGRYAQR+GTGAP+YM Sbjct: 4 AGKVKKGAGGRKGGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAV 63 Query: 46 XXXXXXXXXXXAGNA 2 AGNA Sbjct: 64 LEYLAAEVLELAGNA 78 >ref|XP_003626258.1| Histone H2A [Medicago truncatula] gi|124360019|gb|ABN08035.1| Histone H2A; Histone-fold [Medicago truncatula] gi|355501273|gb|AES82476.1| Histone H2A [Medicago truncatula] Length = 144 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/71 (64%), Positives = 53/71 (74%) Frame = -3 Query: 214 TTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXXXXX 35 TTK AGGRKG ++K VSKS+KAGLQFPVGRIARF+KKGRY+QR+GTGAPIY+ Sbjct: 11 TTKGAGGRKGGERKKAVSKSSKAGLQFPVGRIARFMKKGRYSQRVGTGAPIYLAAVLEYL 70 Query: 34 XXXXXXXAGNA 2 AGNA Sbjct: 71 AAEVLELAGNA 81 >ref|XP_006848587.1| hypothetical protein AMTR_s00168p00048800 [Amborella trichopoda] gi|548851909|gb|ERN10168.1| hypothetical protein AMTR_s00168p00048800 [Amborella trichopoda] Length = 147 Score = 90.1 bits (222), Expect = 3e-16 Identities = 45/74 (60%), Positives = 51/74 (68%) Frame = -3 Query: 223 AGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXX 44 A KT K AGGRKG K+KP SKS KAGLQFPVGRI R+LKKGRY+QR+G GAP+Y+ Sbjct: 4 ASKTKKGAGGRKGGPKKKPTSKSVKAGLQFPVGRITRYLKKGRYSQRVGIGAPVYLAAVL 63 Query: 43 XXXXXXXXXXAGNA 2 AGNA Sbjct: 64 EYLAAEVLELAGNA 77 >ref|XP_002512417.1| histone h2a, putative [Ricinus communis] gi|223548378|gb|EEF49869.1| histone h2a, putative [Ricinus communis] Length = 146 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/76 (60%), Positives = 53/76 (69%) Frame = -3 Query: 229 MEAGKTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXX 50 M+A K K AGGR+G ++K VSKS KAGLQFPVGRIARFLKKGRYAQR G+GAP+Y+ Sbjct: 1 MDAPKEKKGAGGRRGGERKKSVSKSVKAGLQFPVGRIARFLKKGRYAQRFGSGAPVYLAA 60 Query: 49 XXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 VLEYLAAEVLELAGNA 76 >gb|ABK26850.1| unknown [Picea sitchensis] Length = 141 Score = 89.7 bits (221), Expect = 4e-16 Identities = 51/78 (65%), Positives = 55/78 (70%), Gaps = 2/78 (2%) Frame = -3 Query: 229 MEAG-KTTKPAGGRKGSA-KRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYM 56 MEAG K K AGGRKG K+K VSKS KAGLQFPVGRIAR+LKKGRYAQRLGTGAP+Y+ Sbjct: 1 MEAGSKAKKGAGGRKGGGPKKKSVSKSLKAGLQFPVGRIARYLKKGRYAQRLGTGAPVYL 60 Query: 55 XXXXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 AAVLEYLAAEVLELAGNA 78 >gb|ABK23043.1| unknown [Picea sitchensis] Length = 141 Score = 89.7 bits (221), Expect = 4e-16 Identities = 51/78 (65%), Positives = 55/78 (70%), Gaps = 2/78 (2%) Frame = -3 Query: 229 MEAG-KTTKPAGGRKGSA-KRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYM 56 MEAG K K AGGRKG K+K VSKS KAGLQFPVGRIAR+LKKGRYAQRLGTGAP+Y+ Sbjct: 1 MEAGSKAKKGAGGRKGGGPKKKSVSKSLKAGLQFPVGRIARYLKKGRYAQRLGTGAPVYL 60 Query: 55 XXXXXXXXXXXXXXAGNA 2 AGNA Sbjct: 61 AAVLEYLAAEVLELAGNA 78 >ref|XP_006382493.1| hypothetical protein POPTR_0005s02660g [Populus trichocarpa] gi|118484989|gb|ABK94359.1| unknown [Populus trichocarpa] gi|550337854|gb|ERP60290.1| hypothetical protein POPTR_0005s02660g [Populus trichocarpa] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/72 (63%), Positives = 52/72 (72%) Frame = -3 Query: 217 KTTKPAGGRKGSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXXXX 38 K TK AGGR+G ++K VSKS KAGLQFPVGRI+RFLKKGRYA+RLG+GAPIYM Sbjct: 6 KATKGAGGRRGGDRKKSVSKSIKAGLQFPVGRISRFLKKGRYAKRLGSGAPIYMAAVLEY 65 Query: 37 XXXXXXXXAGNA 2 AGNA Sbjct: 66 LAAEVLELAGNA 77 >ref|XP_002274570.1| PREDICTED: probable histone H2A.4 isoform 1 [Vitis vinifera] gi|147769777|emb|CAN63391.1| hypothetical protein VITISV_009336 [Vitis vinifera] Length = 149 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/75 (61%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = -3 Query: 223 AGKTTKPAGGRKGSA-KRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXX 47 AGK K AGGRKG K+KPVS+S KAGLQFPVGRI R+LKKGRY+QR+GTGAP+Y+ Sbjct: 4 AGKVKKGAGGRKGGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAV 63 Query: 46 XXXXXXXXXXXAGNA 2 AGNA Sbjct: 64 LEYLAAEVLELAGNA 78 >ref|XP_007016497.1| Histone H2A 12 isoform 1 [Theobroma cacao] gi|590589604|ref|XP_007016498.1| Histone H2A 12 isoform 1 [Theobroma cacao] gi|508786860|gb|EOY34116.1| Histone H2A 12 isoform 1 [Theobroma cacao] gi|508786861|gb|EOY34117.1| Histone H2A 12 isoform 1 [Theobroma cacao] Length = 149 Score = 88.6 bits (218), Expect = 8e-16 Identities = 46/74 (62%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = -3 Query: 220 GKTTKPAGGRKGSA-KRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXX 44 GK K AGGRKG K+KPVS+S KAGLQFPVGRI R+LKKGRY+QR+GTGAP+YM Sbjct: 5 GKVKKGAGGRKGGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYMAAVL 64 Query: 43 XXXXXXXXXXAGNA 2 AGNA Sbjct: 65 EYLAAEVLELAGNA 78 >dbj|BAC53941.1| H2A histone [Nicotiana tabacum] Length = 148 Score = 88.6 bits (218), Expect = 8e-16 Identities = 49/75 (65%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = -3 Query: 223 AGKTTKPAGGRKGSAKRKP-VSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXX 47 A KTTK AGGRKG RK V+KS KAGLQFPVGRIARFLKKGRYAQR+G+GAPIY+ Sbjct: 4 ATKTTKGAGGRKGGGPRKKSVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYLAAV 63 Query: 46 XXXXXXXXXXXAGNA 2 AGNA Sbjct: 64 LEYLAAEVLELAGNA 78 >gb|AFK44015.1| unknown [Lotus japonicus] Length = 151 Score = 88.6 bits (218), Expect = 8e-16 Identities = 46/74 (62%), Positives = 53/74 (71%), Gaps = 1/74 (1%) Frame = -3 Query: 220 GKTTKPAGGRK-GSAKRKPVSKSTKAGLQFPVGRIARFLKKGRYAQRLGTGAPIYMXXXX 44 GK+ K AGGRK G K+KPVS+S KAGLQFPVGRI R+LKKGRYAQR+GTGAP+Y+ Sbjct: 5 GKSKKGAGGRKAGGPKKKPVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVL 64 Query: 43 XXXXXXXXXXAGNA 2 AGNA Sbjct: 65 EYLAAEVLELAGNA 78