BLASTX nr result
ID: Akebia25_contig00024447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024447 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJT71139.1| hypothetical protein GGTG_10399 [Gaeumannomyces g... 78 1e-12 ref|XP_003003085.1| conserved hypothetical protein [Verticillium... 74 3e-11 gb|EQB53989.1| hypothetical protein CGLO_06227 [Colletotrichum g... 72 6e-11 gb|ELQ34406.1| hypothetical protein OOU_Y34scaffold00767g10 [Mag... 72 1e-10 gb|EFQ25271.1| hypothetical protein GLRG_00415 [Colletotrichum g... 71 2e-10 gb|EWG51321.1| hypothetical protein FVEG_16784 [Fusarium vertici... 67 2e-09 ref|XP_001549940.1| predicted protein [Botryotinia fuckeliana B0... 55 8e-06 >gb|EJT71139.1| hypothetical protein GGTG_10399 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 151 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFK 261 MPFFYSK G RHFGT+V ADR GV RGPWRFS GRFNCFK Sbjct: 108 MPFFYSKAFGGRHFGTSVHADRHGVRRGPWRFSLGRFNCFK 148 >ref|XP_003003085.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261358109|gb|EEY20537.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|346971083|gb|EGY14535.1| hypothetical protein VDAG_05699 [Verticillium dahliae VdLs.17] Length = 41 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFK 261 MPFFY+K VG R FGT++ ADR GV RGPWRF GRFNCFK Sbjct: 1 MPFFYNKSVGGRRFGTSIQADRHGVRRGPWRFRIGRFNCFK 41 >gb|EQB53989.1| hypothetical protein CGLO_06227 [Colletotrichum gloeosporioides Cg-14] Length = 190 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/69 (49%), Positives = 42/69 (60%) Frame = +1 Query: 55 QEYLQVVRITNIVTKKLHHYXXXXXXXXMPFFYSKGVGSRHFGTNVTADRRGVHRGPWRF 234 Q +LQ R+ K H MPFFYSK +G ++FGT+V ADR G+ RGPWRF Sbjct: 127 QAFLQTNRLPANPKNKTHQ-----RTSNMPFFYSKPIGGKNFGTSVHADRHGIRRGPWRF 181 Query: 235 SFGRFNCFK 261 GRFNCF+ Sbjct: 182 RIGRFNCFR 190 >gb|ELQ34406.1| hypothetical protein OOU_Y34scaffold00767g10 [Magnaporthe oryzae Y34] gi|440481122|gb|ELQ61738.1| hypothetical protein OOW_P131scaffold01155g10 [Magnaporthe oryzae P131] Length = 44 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFKS 264 MPFFYSKGVG R FGT++ ADR GV RGPWRF+ FNCFK+ Sbjct: 1 MPFFYSKGVGGRRFGTSIHADRHGVRRGPWRFNICGFNCFKN 42 >gb|EFQ25271.1| hypothetical protein GLRG_00415 [Colletotrichum graminicola M1.001] gi|380492913|emb|CCF34259.1| hypothetical protein CH063_06291 [Colletotrichum higginsianum] Length = 41 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFK 261 MPFFYSK +G R+FGT+V ADR GV RGPWRF GRF+CF+ Sbjct: 1 MPFFYSKPIGGRNFGTSVHADRHGVRRGPWRFRIGRFHCFR 41 >gb|EWG51321.1| hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] gi|587662920|gb|EWY85261.1| hypothetical protein FOYG_12499 [Fusarium oxysporum FOSC 3-a] gi|587689107|gb|EWZ35712.1| hypothetical protein FOZG_11578 [Fusarium oxysporum Fo47] gi|587724955|gb|EWZ96292.1| hypothetical protein FOWG_03707 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587740124|gb|EXA37840.1| hypothetical protein FOVG_11928 [Fusarium oxysporum f. sp. pisi HDV247] gi|590028283|gb|EXK30141.1| hypothetical protein FOMG_13780 [Fusarium oxysporum f. sp. melonis 26406] gi|590062745|gb|EXK90269.1| hypothetical protein FOQG_07096 [Fusarium oxysporum f. sp. raphani 54005] gi|591420113|gb|EXL55250.1| hypothetical protein FOCG_05914 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591449386|gb|EXL81768.1| hypothetical protein FOPG_05108 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591474467|gb|EXM05656.1| hypothetical protein FOIG_04172 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591497742|gb|EXM27212.1| hypothetical protein FOTG_06566 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 42 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFK 261 M F+SKGVG RHFGT+V D+ GV RGPWRFS G+F+CF+ Sbjct: 1 MGLFWSKGVGGRHFGTSVHVDKHGVRRGPWRFSLGKFSCFR 41 >ref|XP_001549940.1| predicted protein [Botryotinia fuckeliana B05.10] Length = 41 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +1 Query: 139 MPFFYSKGVGSRHFGTNVTADRRGVHRGPWRFSFGRFNCFK 261 MP F+SKGVG R FG N+TADR GV + WR NCF+ Sbjct: 1 MPLFWSKGVGGRRFGANITADRHGVRKPVWRMRLCGLNCFR 41