BLASTX nr result
ID: Akebia25_contig00024391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024391 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27735.3| unnamed protein product [Vitis vinifera] 68 2e-09 emb|CAN66773.1| hypothetical protein VITISV_006775 [Vitis vinifera] 68 2e-09 gb|EMT08768.1| Brefeldin A-inhibited guanine nucleotide-exchange... 67 2e-09 gb|EMS61589.1| Brefeldin A-inhibited guanine nucleotide-exchange... 67 2e-09 ref|XP_003560084.1| PREDICTED: brefeldin A-inhibited guanine nuc... 67 2e-09 ref|XP_007012491.1| HOPM interactor 7 isoform 1 [Theobroma cacao... 67 3e-09 ref|XP_006658699.1| PREDICTED: brefeldin A-inhibited guanine nuc... 67 3e-09 ref|XP_002309445.2| hypothetical protein POPTR_0006s23350g [Popu... 67 3e-09 ref|NP_001060005.1| Os07g0564700 [Oryza sativa Japonica Group] g... 67 3e-09 gb|EEE67420.1| hypothetical protein OsJ_24760 [Oryza sativa Japo... 67 3e-09 gb|EAY95525.1| hypothetical protein OsI_17371 [Oryza sativa Indi... 67 3e-09 ref|XP_006600423.1| PREDICTED: brefeldin A-inhibited guanine nuc... 66 4e-09 ref|XP_006593978.1| PREDICTED: brefeldin A-inhibited guanine nuc... 66 4e-09 ref|XP_003609924.1| Brefeldin A-inhibited guanine nucleotide-exc... 66 4e-09 ref|NP_001182817.1| hypothetical protein [Zea mays] gi|224035265... 66 4e-09 ref|XP_004958042.1| PREDICTED: brefeldin A-inhibited guanine nuc... 65 1e-08 ref|XP_004508055.1| PREDICTED: brefeldin A-inhibited guanine nuc... 65 1e-08 ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nuc... 65 1e-08 tpg|DAA63152.1| TPA: hypothetical protein ZEAMMB73_360047 [Zea m... 65 1e-08 ref|XP_002463030.1| hypothetical protein SORBIDRAFT_02g036510 [S... 65 1e-08 >emb|CBI27735.3| unnamed protein product [Vitis vinifera] Length = 1778 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLFS Q Sbjct: 1740 RRHLREFYPLITKLVCCDQMDVRGALGDLFSTQ 1772 >emb|CAN66773.1| hypothetical protein VITISV_006775 [Vitis vinifera] Length = 251 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLFS Q Sbjct: 213 RRHLREFYPLITKLVCCDQMDVRGALGDLFSTQ 245 >gb|EMT08768.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Aegilops tauschii] Length = 730 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KHLREFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 692 KKHLREFYPLITKLICCDQMDVRGALGDLFSKQ 724 >gb|EMS61589.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Triticum urartu] Length = 1554 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KHLREFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1516 KKHLREFYPLITKLICCDQMDVRGALGDLFSKQ 1548 >ref|XP_003560084.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Brachypodium distachyon] Length = 1712 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KHLREFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1674 KKHLREFYPLITKLICCDQMDVRGALGDLFSKQ 1706 >ref|XP_007012491.1| HOPM interactor 7 isoform 1 [Theobroma cacao] gi|590574750|ref|XP_007012492.1| HOPM interactor 7 isoform 1 [Theobroma cacao] gi|508782854|gb|EOY30110.1| HOPM interactor 7 isoform 1 [Theobroma cacao] gi|508782855|gb|EOY30111.1| HOPM interactor 7 isoform 1 [Theobroma cacao] Length = 1793 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 RKHLREFYPL TKLVCCDQMDVRGALGDLF Q Sbjct: 1755 RKHLREFYPLLTKLVCCDQMDVRGALGDLFRAQ 1787 >ref|XP_006658699.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Oryza brachyantha] Length = 1716 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KH+REFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1678 KKHIREFYPLITKLICCDQMDVRGALGDLFSKQ 1710 >ref|XP_002309445.2| hypothetical protein POPTR_0006s23350g [Populus trichocarpa] gi|550336927|gb|EEE92968.2| hypothetical protein POPTR_0006s23350g [Populus trichocarpa] Length = 1611 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLF +Q Sbjct: 1573 RRHLREFYPLLTKLVCCDQMDVRGALGDLFRVQ 1605 >ref|NP_001060005.1| Os07g0564700 [Oryza sativa Japonica Group] gi|34393201|dbj|BAC82915.1| guanine nucleotide-exchange protein-like [Oryza sativa Japonica Group] gi|113611541|dbj|BAF21919.1| Os07g0564700 [Oryza sativa Japonica Group] Length = 264 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KH+REFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 226 KKHIREFYPLITKLICCDQMDVRGALGDLFSKQ 258 >gb|EEE67420.1| hypothetical protein OsJ_24760 [Oryza sativa Japonica Group] Length = 1650 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KH+REFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1612 KKHIREFYPLITKLICCDQMDVRGALGDLFSKQ 1644 >gb|EAY95525.1| hypothetical protein OsI_17371 [Oryza sativa Indica Group] Length = 1680 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 +KH+REFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1642 KKHIREFYPLITKLICCDQMDVRGALGDLFSKQ 1674 >ref|XP_006600423.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Glycine max] Length = 1782 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLF Q Sbjct: 1744 RRHLREFYPLLTKLVCCDQMDVRGALGDLFQAQ 1776 >ref|XP_006593978.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like isoform X1 [Glycine max] Length = 1782 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLF Q Sbjct: 1744 RRHLREFYPLLTKLVCCDQMDVRGALGDLFQAQ 1776 >ref|XP_003609924.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] gi|355510979|gb|AES92121.1| Brefeldin A-inhibited guanine nucleotide-exchange protein [Medicago truncatula] Length = 1937 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQMDVRGALGDLF Q Sbjct: 1899 RRHLREFYPLLTKLVCCDQMDVRGALGDLFQAQ 1931 >ref|NP_001182817.1| hypothetical protein [Zea mays] gi|224035265|gb|ACN36708.1| unknown [Zea mays] gi|414590551|tpg|DAA41122.1| TPA: hypothetical protein ZEAMMB73_013959 [Zea mays] Length = 264 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HL+EFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 226 RRHLKEFYPLITKLICCDQMDVRGALGDLFSKQ 258 >ref|XP_004958042.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Setaria italica] Length = 1705 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 ++HL+EFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1667 KRHLKEFYPLITKLICCDQMDVRGALGDLFSKQ 1699 >ref|XP_004508055.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Cicer arietinum] Length = 1775 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL T+LVCCDQMDVRGALGDLF Q Sbjct: 1737 RRHLREFYPLLTRLVCCDQMDVRGALGDLFQAQ 1769 >ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] gi|449480318|ref|XP_004155860.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] Length = 1783 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 R+HLREFYPL TKLVCCDQ+D+RGALGDLF +Q Sbjct: 1745 RRHLREFYPLLTKLVCCDQIDIRGALGDLFKIQ 1777 >tpg|DAA63152.1| TPA: hypothetical protein ZEAMMB73_360047 [Zea mays] Length = 1721 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 ++HL+EFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1683 KRHLKEFYPLITKLICCDQMDVRGALGDLFSKQ 1715 >ref|XP_002463030.1| hypothetical protein SORBIDRAFT_02g036510 [Sorghum bicolor] gi|241926407|gb|EER99551.1| hypothetical protein SORBIDRAFT_02g036510 [Sorghum bicolor] Length = 1687 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 RKHLREFYPLFTKLVCCDQMDVRGALGDLFSMQ 101 ++HL+EFYPL TKL+CCDQMDVRGALGDLFS Q Sbjct: 1649 KRHLKEFYPLITKLICCDQMDVRGALGDLFSKQ 1681