BLASTX nr result
ID: Akebia25_contig00024314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024314 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27550.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] 67 3e-09 ref|XP_006484038.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006438113.1| hypothetical protein CICLE_v10031257mg [Citr... 57 3e-06 ref|XP_004239182.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|XP_006341756.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >emb|CBI27550.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 5 ITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQMKTSK 118 ITPRY+TC LLLDE+KQKNMHD AERIEV MKQMKTS+ Sbjct: 293 ITPRYKTCALLLDEIKQKNMHDAAERIEVFMKQMKTSE 330 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 5 ITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQMKTSK 118 ITPRY+TC LLLDE+KQKNMHD AERIEV MKQMKTS+ Sbjct: 459 ITPRYKTCALLLDEIKQKNMHDAAERIEVFMKQMKTSE 496 >emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] Length = 324 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 5 ITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQMKTS 115 ITPRY+TC LLLDE+KQKNMHD AE IEV MKQMKTS Sbjct: 149 ITPRYKTCALLLDEIKQKNMHDAAEGIEVFMKQMKTS 185 >ref|XP_006484038.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like isoform X1 [Citrus sinensis] Length = 515 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 EITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQM 106 +ITPRYQTC L+LDEVKQK+M+D AE+IE VMK++ Sbjct: 481 DITPRYQTCRLILDEVKQKHMYDAAEKIEAVMKKL 515 >ref|XP_006438113.1| hypothetical protein CICLE_v10031257mg [Citrus clementina] gi|557540309|gb|ESR51353.1| hypothetical protein CICLE_v10031257mg [Citrus clementina] Length = 515 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +2 Query: 2 EITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQM 106 +ITPRYQTC L+LDEVKQK+M+D AE+IE VMK++ Sbjct: 481 DITPRYQTCRLILDEVKQKHMYDAAEKIEAVMKKL 515 >ref|XP_004239182.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Solanum lycopersicum] Length = 518 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = +2 Query: 2 EITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQMKTS 115 EITPRY+TC +LL E+KQKNM++ A++IE+ MK+MK + Sbjct: 481 EITPRYKTCSVLLQEIKQKNMYEAADKIELFMKKMKAA 518 >ref|XP_006341756.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Solanum tuberosum] Length = 522 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/36 (63%), Positives = 32/36 (88%) Frame = +2 Query: 2 EITPRYQTCCLLLDEVKQKNMHDIAERIEVVMKQMK 109 EITPRY+TC +LL E+KQKNM++ A++IE+ MK+MK Sbjct: 485 EITPRYKTCSVLLQEIKQKNMYEAADKIELFMKKMK 520