BLASTX nr result
ID: Akebia25_contig00024307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00024307 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME43651.1| hypothetical protein DOTSEDRAFT_72870 [Dothistrom... 67 3e-09 gb|EMC96966.1| hypothetical protein BAUCODRAFT_23378 [Baudoinia ... 62 1e-07 gb|EMC94242.1| hypothetical protein BAUCODRAFT_36711 [Baudoinia ... 60 2e-07 gb|EME82323.1| hypothetical protein MYCFIDRAFT_211595 [Pseudocer... 59 9e-07 >gb|EME43651.1| hypothetical protein DOTSEDRAFT_72870 [Dothistroma septosporum NZE10] Length = 193 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 234 CMTDDEATRVANNFKTLISAYTNASAEAYLCTSFTDYSDSV 356 CMTDD+A RVANNF+TLI+ Y+NA+A LCT FTDYSDSV Sbjct: 24 CMTDDDANRVANNFRTLITDYSNATAAQVLCTDFTDYSDSV 64 >gb|EMC96966.1| hypothetical protein BAUCODRAFT_23378 [Baudoinia compniacensis UAMH 10762] Length = 603 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 234 CMTDDEATRVANNFKTLISAYTNASAEAYLCTSFTDYSDSV 356 CM DD+A +VANNFK LI+AYTNA+A+A L T+ DYSDSV Sbjct: 41 CMNDDQANQVANNFKALIAAYTNATADAVLTTTVNDYSDSV 81 >gb|EMC94242.1| hypothetical protein BAUCODRAFT_36711 [Baudoinia compniacensis UAMH 10762] Length = 204 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/53 (58%), Positives = 41/53 (77%) Frame = +3 Query: 198 PSLRRRDDDDQWCMTDDEATRVANNFKTLISAYTNASAEAYLCTSFTDYSDSV 356 P+L ++D +D CMT D+AT VANNFK+LI+AY++A A +L FTDYSDSV Sbjct: 19 PTLVKKDCNDT-CMTYDQATVVANNFKSLIAAYSDADAIEFLTPDFTDYSDSV 70 >gb|EME82323.1| hypothetical protein MYCFIDRAFT_211595 [Pseudocercospora fijiensis CIRAD86] Length = 199 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 234 CMTDDEATRVANNFKTLISAYTNASAEAYLCTSFTDYSDSV 356 C+ D A +VA+NF+TLI++Y+NASAEAYL FTDYSDSV Sbjct: 30 CIDDAGAQKVADNFRTLITSYSNASAEAYLTQDFTDYSDSV 70